CAZyme Information: P174DRAFT_448135-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_448135-t37_1-p1
• CAZy Family: GH38
• CAZyme Description: putative cellulase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
501	MSZS01000002|CGC22	55447.42	5.7290

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000002:147610-149171(-)

Full Sequence      

MLFTPIAAASLLAVLGTQPAGVLAQDAEGWYKAHSGMARISQVNQDTHQIVDEFGRTRFF
HGTNVVMKESPWYRPLEWSPGVSSFGEQDVQNLHGLGLNIVRLGHSWAGAEPVRGQYNQT
FLEILKKQTKMAEDHGLYVLVDVHQDVLARQLCGHGVPDWFVKKDWVPGWKMYPFPLKLT
PFPVDNNGFPSPQSLCGTVDWSLSYTSVAVSNAFGRLYNNYDGLGDAFAAYWKKLASEYV
GTTNVVGYNLLNEPWVGDSMADPTLLVPGVADHKVLEGLWNRAAKQIRTVDNDTLIWFEG
ATIDILSGFNNVPLGDGSKSVHSFHYYSPPQLSSISTTLDNRRKDNERLRTAGVLTELTF
WMGDDKQMQGLADAMSATDENMVSWIGWAYENLYNGTSGQPYPELAKHYSRAYPAAVAGT
PNSFSFDESSGTFKLQFTSDPNIEAPTEIILPPSTFPNGYKVHVSPDSSLLQYVLNKRTL
ALFTSTSIKNAIDISVTVSPK

Enzyme Prediction     

No EC number prediction in P174DRAFT_448135-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	59	390	2e-133	0.9969135802469136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	1.39e-19	411	496	1	86	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.
395098	Cellulase	2.56e-09	66	390	13	268	Cellulase (glycosyl hydrolase family 5).
396834	Glyco_hydro_42	9.35e-05	73	156	2	96	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
224786	GanA	0.002	73	166	22	103	Beta-galactosidase GanA [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW30510.1|GH5_27	0.0	1	501	3	503
QMW42568.1|GH5_27	0.0	1	501	3	503
UDD59314.1|GH5_27	0.0	1	501	3	503
BAE60253.1|GH5_27	0.0	1	501	3	503
QRD89368.1|GH5_27	0.0	1	481	3	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CCU_A	2.91e-30	40	464	41	446	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5CCU_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]
5J14_A	9.89e-30	40	464	41	446	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J14_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_A Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]
2OSW_A	2.63e-24	52	500	39	479	Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OSW_B Endo-glycoceramidase II from Rhodococcus sp. [Rhodococcus sp.],2OYK_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYK_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like isofagomine complex [Rhodococcus sp.],2OYL_A Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYL_B Endo-glycoceramidase II from Rhodococcus sp.: cellobiose-like imidazole complex [Rhodococcus sp.],2OYM_A Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.],2OYM_B Endo-glycoceramidase II from Rhodococcus sp.: five-membered iminocyclitol complex [Rhodococcus sp.]
2OSX_A	4.76e-24	52	500	39	479	Chain A, Endoglycoceramidase II [Rhodococcus sp.]
6JYZ_A	2.40e-16	36	419	18	415	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9GV16|EGCSE_CYANO	4.37e-87	43	480	34	483	Endoglycoceramidase OS=Cyanea nozakii OX=135523 PE=1 SV=1
sp|Q6L6S1|EGCSE_HYDVU	3.48e-82	43	467	25	454	Endoglycoceramidase OS=Hydra vulgaris OX=6087 PE=1 SV=1
sp|A0A3S5YBC7|EGCSE_RHOH1	1.38e-29	40	464	33	438	Endoglycoceramidase I OS=Rhodococcus hoagii (strain 103S) OX=685727 GN=REQ_38260 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000263	0.999698	CS pos: 24-25. Pr: 0.9692

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_448135-t37_1-p1.