CAZyme Information: P174DRAFT_445838-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_445838-t37_1-p1
• CAZy Family: GH32
• CAZyme Description: chondroitin AC/alginate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408		44564.14	7.0645

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000010:318939-320185(-)

Full Sequence      

MKLLLISCLNLFVSLSSSLSLPNGHGRHGPIPKTVVIDGARLVENKLRLRAGDASFTVAL
DHLTAEADSWLSQGPWTVTSKTQAPPNGTIHDYASQAPYWWPSNTTDGCPYVDRDGERNP
EVEKYPDHSGRDSMFRSSYILSLAWYYTGQTKYAKHASLILETWFIDPATAMTPNLRHAQ
IIPCRNDGRSIGIIDFSMEYTNVLDAAAILASTNAPGWTRANQRAFMNWNRQFLDWLVDS
PFGKEEAGQENNHGTFANMQIAALALFTGNTSLSKKTSQGAKSLIDIQIRPNGSQPMELA
RTRSWHYSNFNLGAHLRFALVAKKVGGAGGQSLFGATNFLLKAAAEGKSAWGFEELEFKP
YAATDNVHAAADAGDSKAQAVVPQLPPPPTGDIYVLRPAAEQLDNIAG

Enzyme Prediction     

No EC number prediction in P174DRAFT_445838-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	78	342	1e-91	0.967741935483871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	1.70e-86	77	351	1	274	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT05465.1|PL38	1.53e-180	31	407	33	416
UKZ57530.1|PL38	5.06e-179	31	407	33	416
UKZ83240.1|PL38	5.06e-179	31	407	33	416
OTA06285.1|PL38	1.86e-177	31	407	35	419
UKZ91858.1|PL38	1.63e-175	15	407	16	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	3.92e-55	29	357	1	334	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

P174DRAFT_445838-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999743	CS pos: 18-19. Pr: 0.9793

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_445838-t37_1-p1.