CAZyme Information: P174DRAFT_444346-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_444346-t37_1-p1
• CAZy Family: GH3
• CAZyme Description: putative BNR/Asp-box repeat protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		40510.48	6.8130

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000007:158968-160062(+)

Full Sequence      

MPGHFGQKILKTFGLDDQRGHHPFKPQNDARLPGNRLINNDERLLSSEPYGTYPRLAKLS
DGSILSAFTRFAGQSRILMVAKSTDGGRTFRDFGEVTRGQGDCDNLFLLEVAPSIVLGAF
RNHDLGPHGPTHFRITVCRSTDGGRSWQYASQAVEKSPPNGIWEPFMRLGRQGEVQLFYS
QEYAHDNQCTMLVRSSDQGSSWSQPECLEGINDRIRDGMTGIASTVDNGREALVMVFETT
RYGTFNLEALLSYDDGRTWGWRHEVYVPPRGHNAGAPQIASFADGSLAVIFMTDEDEREV
QWTKNACIKMVFAGPPQDGRISWTRPTVICPHTSHWPGVLALDHHTLLAVYECGGPKGKT
VTLQ

Enzyme Prediction     

No EC number prediction in P174DRAFT_444346-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	51	309	1.9e-69	0.9022801302931596

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	2.68e-10	114	358	26	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	3.46e-09	68	296	103	327	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
404074	BNR_2	4.20e-04	135	329	20	204	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
271234	Sialidase_non-viral	0.005	46	150	194	296	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
404074	BNR_2	0.009	59	209	119	258	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA62412.1|GH93	2.97e-201	1	364	1	367
QMW42642.1|GH93	1.25e-198	1	363	1	378
QMW30589.1|GH93	1.25e-198	1	363	1	378
QRD89469.1|GH93	1.25e-198	1	363	1	378
BAE60328.1|GH93	1.25e-198	1	363	1	378

PDB Hits     

P174DRAFT_444346-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

P174DRAFT_444346-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000005

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_444346-t37_1-p1.