CAZyme Information: P174DRAFT_441124-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_441124-t37_1-p1
• CAZy Family: GH28
• CAZyme Description: putative beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473		53354.94	4.9735

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000004:1068494-1070215(+)

Full Sequence      

MGSTTTSTLPPDFLWGFATASYQIEGAVDEDGRGPSIWDTFCKTPGKIAGGASGEVACDS
YHRTHEDIALLKECGAKAYRFSISWSRVIPLGGRNDPVNEKGLQHYIKFVDDLLAAGITP
LVTLFHWDLPDALDKRYGGLLNKEEFVADFANYARVMYNAFGSKVKYWITFNEPWCSSVL
GYNVGQFAPGRTSDRTKSSVGDGSREPWIVGHNILVAHGAAVKIYREEFKPRDGGEIGIT
LNGDWAEPWDPENPADVEACDRKIEFAISWFADPIYHGKYPDSMVKQLDIALVHGSNDFY
GMNHYCANYIKAKTGEPDPNDVAGNLEILLQNKNGEWIGPETQSPWLRPQPIGFRKLLKW
LSDRYNQPKIYVTENGTSLKGENDLPVDQILNDEFRVQYFRDYIAAMADAYTLDGVNVRA
YMAWSLMDNFEWAEGYETRFGVTFVDYANNQKRIPKKSAKVLREIFDQYIEKA

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	7	467	9.2e-161	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	3.64e-180	8	465	4	447	Glycosyl hydrolase family 1.
274539	BGL	9.97e-179	10	460	1	424	beta-galactosidase.
225343	BglB	1.66e-145	6	467	1	451	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215455	PLN02849	2.46e-106	7	459	28	473	beta-glucosidase
215435	PLN02814	1.45e-104	5	459	24	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD82378.1|GH1	0.0	1	473	1	483
QMW27934.1|GH1	0.0	1	473	1	483
UDD55888.1|GH1	0.0	1	473	1	483
QMW40005.1|GH1	0.0	1	473	1	483
CAK47813.1|GH1	0.0	1	472	1	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	6.08e-274	8	472	25	498	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	1.08e-233	9	472	3	465	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	1.18e-230	9	472	3	465	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	2.36e-230	9	472	22	484	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	4.36e-230	9	473	9	473	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	5.40e-181	9	470	11	475	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	6.56e-173	9	471	6	461	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q9SPP9|RG1_RAUSE	3.29e-135	7	472	20	517	Raucaffricine-O-beta-D-glucosidase OS=Rauvolfia serpentina OX=4060 GN=RG PE=1 SV=1
sp|Q5Z9Z0|BGL24_ORYSJ	1.20e-134	7	463	31	499	Beta-glucosidase 24 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU24 PE=2 SV=1
sp|Q9M1D0|BGL16_ARATH	1.87e-133	10	465	36	499	Beta-glucosidase 16 OS=Arabidopsis thaliana OX=3702 GN=BGLU16 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000001

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_441124-t37_1-p1.