CAZyme Information: P174DRAFT_440797-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_440797-t37_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436		49905.75	5.5329

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000003:3981410-3982766(-)

Full Sequence      

MPLFQPWTRLPSRRIYLLSPVIGLLLVYFFFCFDTDVFTPQVVVTPISPQQEQATCPPLP
GIEDVLVILKTGVTEALEKVPVHFETTLRCVPNYVLFSDFEEEINGTRVHDVLRNVNETV
KHTSPDFDLYNRIHEHGRSGLTPADLSRVPNTAFGMPDNPGWKLDKWKFLPLIDETLRVR
DDAKWYVFMEADTYYIWSNLLQWLAKLDPNKPYYLGNPTQIGPDIFGHGGSGFILSREAM
RRASELRAEDLDGWDRYTGEQWAGDCVLGRLLHDAGVPLLWSWPMLQSNTPAEFDHFSEA
YFKKPWCFPAVSYHHVTAEDIHELAKFDHRFMHNNSVILHSDVFRHLVHPQFKPLQPDWD
NLSDEEHDIGAASCQELCASEPECLQYSYEAGKCRTSKKAKIGVPKTGVSSGWMTDRIDA
VVKELGSCTKPQWVLP

Enzyme Prediction     

No EC number prediction in P174DRAFT_440797-t37_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	0.007	181	288	83	203	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
238533	APPLE_Factor_XI_like	0.008	364	412	20	70	Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW28702.1|GT31	7.52e-169	1	435	1	438
QRD83231.1|GT31	7.52e-169	1	435	1	438
UDD56757.1|GT31	7.52e-169	1	435	1	438
BAE58433.1|GT31	1.07e-168	1	435	1	438
QMW40773.1|GT31	6.11e-168	1	435	1	438

PDB Hits     

P174DRAFT_440797-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0VC84|C1GLT_BOVIN	3.00e-07	181	324	160	319	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=C1GALT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000011	0.000013

TMHMM  Annotations     

Start	End
15	33