CAZyme Information: P174DRAFT_438103-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_438103-t37_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		40696.20	6.7678

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000001:5065959-5067299(-)

Full Sequence      

MAVVMTLWNSKVIKIIAGFLFSILLLNALISNGVDYTATRHMTIQNETLGFEHVYAIGLK
ERTDKRDFLALAASIVGFQVDWLDGVKPDEVHPKSLPQGMNMTIIKPTVAACWRAHMNAL
RTVVEKRHATALIMEDDADWDVSLKQQLREFARGLRTLSPTKTASKQAPYGTDWDLLWVG
GCSTAAGVNETQFYAIPNDPTVPGMNRRSFWESTRYVYRADTGCCLYGYAVTYNGARKIL
ASLSVDHLEIPVDNALGDMCGGKNRPRIQCYAPHPNLIATHRRAGSSYKDSDIETYGQDN
WHPDEAWDLVYSTKLNLHRLLAGNETVTSQWPDDHKPWSPAELKVKEFQYPQGFHVAYSD
DV

Enzyme Prediction     

No EC number prediction in P174DRAFT_438103-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	51	255	4.8e-30	0.988950276243094

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	5.35e-15	53	141	1	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
225843	COG3306	2.28e-04	50	253	1	184	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK45731.1|GT25	4.37e-148	44	356	56	385
BAE63398.1|GT25	5.10e-142	1	357	1	395
QRD94314.1|GT25	5.10e-142	1	357	1	395
UDD62811.1|GT25	5.10e-142	1	357	1	395
CAP93867.1|GT25	5.72e-141	44	355	60	383

PDB Hits     

P174DRAFT_438103-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5PK45|GT251_BOVIN	1.33e-08	39	322	326	602	Procollagen galactosyltransferase 1 OS=Bos taurus OX=9913 GN=COLGALT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999944	0.000089

TMHMM  Annotations     

Start	End
12	34