CAZyme Information: P174DRAFT_436859-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_436859-t37_1-p1
• CAZy Family: GH18
• CAZyme Description: putative aryl-alcohol dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544		58837.00	6.8983

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000001:1562360-1563994(-)

Full Sequence      

MTIPRADMLFRQQQLNGRQLLASKGRTLGGSSAINLGLVIYPSRSGMNAWEALGNPGWGW
DGVEPYLRKFHQASPPSNAIREFFMGMKYDQEDQGSTGPVRVSFGDQYMPFHGAWMETFR
NLGYPQVEDPIRGAGTGPFVSPGAVDPVTHTRSHAGSAYFDADVQRRPNLRVVTGALVDR
IVLDVREASVVATGVQFCKGDRKYTVPATKEVILAAGATQTPQILELSGIGSADLLRSHG
IIPIVDNPNVGENLQDHGLVCFGYEVADGIPSGDVARDPAVAAAAMEAYKKDGSGPLGMV
PLVSAFMPCMNLSTTERHQLLATIDASIASGNLPRAQQKQYPVLRKLLEDPDEPTAQYIL
APFQVLPREGNSPKGLFSMSHPGCFITIASALSYPLSRGSVHLQSADTKAAPAIDHGTLR
HPADLELHARHSIWTETLAETEPMASLLKKKGARLHTRERLTDVERAKELCKELVLSEWH
TSGSCAMMPRDDGGVVGPKLKVYGTANVRVVDASVFPLEPRGNIQATVFAVAEKAADIIK
QDTF

Enzyme Prediction     

No EC number prediction in P174DRAFT_436859-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	11	542	1.8e-143	0.8838028169014085

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.96e-69	4	542	60	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	4.64e-64	12	540	72	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	5.59e-33	395	535	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.98e-33	16	257	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	9.94e-24	169	528	234	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS27275.1|AA3_2	1.20e-271	4	542	71	616
BCS13057.1|AA3_2	1.80e-181	12	542	81	613
BCS01313.1|AA3_2	1.80e-181	12	542	81	613
QGA17771.1|AA3_2	1.36e-179	12	542	81	611
CAK40027.1|AA3_2	6.45e-179	12	542	80	612

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	1.12e-62	12	542	68	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	6.72e-54	12	542	70	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6O9N_A	1.18e-48	25	542	115	641	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6XUT_A	2.81e-41	25	540	87	588	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
3Q9T_A	2.13e-40	23	542	85	572	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	1.20e-69	12	542	79	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.20e-69	12	542	79	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	2.37e-64	12	542	111	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	4.81e-64	24	542	91	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	2.29e-57	12	539	114	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999922	0.000125

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_436859-t37_1-p1.