CAZyme Information: P174DRAFT_429980-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_429980-t37_1-p1
• CAZy Family: GH18
• CAZyme Description: putative endo-beta-1,4-glucanase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329	MSZS01000003|CGC23	36035.45	4.5519

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000003:2385744-2387004(+)

Full Sequence      

MKFGNLVLIAAAAGSAVAAPAKRASVFQWFGSNESGAEFGQNTIPGSYGKEFIFPDPSTI
STLIGKGMNIFRIQFLMERLVPSSMTGTYNEEYLTNLTSVVDAVTKAGSYAILDPHNYGR
YNGQIISSTDDFKTFWQNLAGQFKSNNLVIFDTNNEYHDMDQTLVLNLNQAAINGIRAAG
ATSQYIFVEGNSWTGAWTWVDVNDNLKALTDPQDKIVYEMHQYLDSDGSGTSENCVSTTI
GKERVTAATKWLKDNGKVGIIGEFAGGVNDQCRTAISGMLEYLAQNTDVWKGALWWAAGP
WWGNYMYSMEPPSGAAYVGMLDILKPYLG

Enzyme Prediction     

EC	3.2.1.4:38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	29	306	3.9e-114	0.9964539007092199

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	2.72e-76	33	299	2	272	Cellulase (glycosyl hydrolase family 5).
225344	BglC	3.49e-20	25	329	43	392	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAB62319.1|GH5_5	4.43e-197	1	328	1	332
BCS06954.1|GH5_5	4.43e-197	1	328	1	332
AAG50051.1|GH5_5|3.2.1.4	5.16e-196	1	328	1	332
AAE84292.1|GH5_5	2.87e-195	1	328	1	331
AAE60102.1|GH5_5	2.87e-195	1	328	1	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5I77_A	4.94e-190	26	328	1	302	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]
5I79_A	4.36e-189	26	328	3	304	Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger],5I79_B Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger]
5I78_A	4.52e-189	26	328	4	305	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger],5I78_B Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]
1GZJ_A	6.33e-175	26	328	2	304	Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus],1GZJ_B Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus]
1H1N_A	4.40e-173	24	328	1	305	Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus],1H1N_B Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DME8|EGLB_NEOFI	7.50e-241	1	329	1	329	Probable endo-beta-1,4-glucanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglB PE=3 SV=1
sp|Q96WQ8|EGLB_ASPKW	7.87e-198	1	328	1	332	Probable endo-beta-1,4-glucanase B OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=eglB PE=3 SV=1
sp|A2QPC3|EGLB_ASPNC	5.10e-196	1	328	1	331	Probable endo-beta-1,4-glucanase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglB PE=3 SV=1
sp|O74706|EGLB_ASPNG	5.10e-196	1	328	1	331	Endo-beta-1,4-glucanase B OS=Aspergillus niger OX=5061 GN=eglB PE=1 SV=1
sp|Q2UPQ4|EGLB_ASPOR	1.75e-192	1	329	1	333	Probable endo-beta-1,4-glucanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000277	0.999703	CS pos: 18-19. Pr: 0.9806

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_429980-t37_1-p1.