CAZyme Information: P174DRAFT_425181-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_425181-t37_1-p1
• CAZy Family: GH17
• CAZyme Description: alginate lyase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
247	MSZS01000010|CGC5	27037.60	7.9107

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000010:321294-322037(+)

Full Sequence      

MAIKNLIPIALFVLVHFSPMTMAQGSACAPGGTFDLSKWKLQLPTGKAGSPDEVSASELK
GCNGYKSEYFFTSPDDGSLVMKVPGSTSTTDCVTTPNSKHCRTELRENSPSKWSPSASKN
RLFGDLIVKQIKDDRVVVGQIHIDGSISTKPVCELYYSSKGDLTMGVNRCRTCGQDTFTV
GHVPVGQRFTYEIRYEKGILSVSLNGQAFQKLDTFDLDNPDSYFKAGNYNQGNGPTEVHF
FAIRVSH

Enzyme Prediction     

No EC number prediction in P174DRAFT_425181-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL7	34	247	1.2e-83	0.9953271028037384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400923	Alginate_lyase2	2.34e-66	34	247	1	222	Alginate lyase. Alginate lyases are enzymes that degrade the linear polysaccharide alignate. They cleave the glycosidic linkage of alignate through a beta-elimination reaction. This family forms an all beta fold and is different to all alpha fold of pfam05426.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL03277.1|PL7_4	8.04e-101	17	247	18	250
UKZ58697.1|PL7_4	2.80e-96	23	247	19	249
UNI24701.1|PL7_4	3.85e-96	13	247	14	247
UKZ86442.1|PL7_4	3.06e-93	23	247	19	249
OTA01262.1|PL7_4	5.95e-93	23	247	18	248

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7NDE_A	1.29e-58	27	247	6	231	Chain A, Glucuronan lyase [Trichoderma parareesei]
2ZA9_A	1.12e-20	27	247	2	226	Chain A, Alginate lyase [unidentified]
2CWS_A	1.60e-20	27	247	3	227	Crystal structure at 1.0 A of alginate lyase A1-II', a member of polysaccharide lyase family-7 [Sphingomonas sp. A1],2Z42_A Crystal Structure of Family 7 Alginate Lyase A1-II' from Sphingomonas sp. A1 [Sphingomonas sp.]
2ZAB_A	5.87e-20	27	247	2	226	Chain A, Alginate lyase [Sphingomonas sp. A1],2ZAC_A Chain A, Alginate lyase [Sphingomonas sp. A1]
2ZAA_A	5.90e-19	27	247	2	226	Chain A, Alginate lyase [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59478|ALYA_KLEPN	6.78e-07	23	231	18	282	Alginate lyase OS=Klebsiella pneumoniae OX=573 GN=alyA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000193	0.999778	CS pos: 23-24. Pr: 0.9764

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_425181-t37_1-p1.