CAZyme Information: P174DRAFT_422893-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_422893-t37_1-p1
• CAZy Family: GH16
• CAZyme Description: putative glycosyl hydrolase, family 18

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426		46443.05	4.6459

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000006:1218182-1219665(-)

Full Sequence      

MLKSLVFSLMAVQAAMGLRFAMYIDQYHTVDLPGSDQTQGITHAIMAFAPSKQFNTDSSF
TPFDTVENMRKRFAPDTKVMIAIGGWGDTAGFSEGAKDEASRTKYAKNVATMIDNLGFDG
VDIDWEYSGGNGDDYKKVPNSQKTGEIETYPLFLQAIREAIGKDKLLSVAVPGKRGDMLA
FTKEQGPKIWSTVDMVNVMSYDLMNRRDNVTNHHTSVAGSLDTIKAYEEMGLDTAKMNLG
FAYYAKWFTTDPNSDCAEQPIGCAVVALENSDGSDPGKSGALTFEKSTMAAAPDSLRTSS
DGTCGYAKGTKCPSGSCCSQYGNCGTGDDFCQAGCLSDYGECKGISVTDSWRRALKDGKT
DEQGGGQYYWDSTANLFWTWDTPAMIDRKFKEIVDAEKLGGVMAWSLGEDTLNWEHLKAM
QKGLGQ

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	35	416	1.2e-54	0.8682432432432432

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395573	Glyco_hydro_18	2.50e-79	19	410	1	307	Glycosyl hydrolases family 18.
214753	Glyco_18	9.87e-49	26	410	11	334	Glyco_18 domain.
119349	GH18_chitinase-like	5.98e-43	20	203	1	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119365	GH18_chitinase	1.35e-35	21	244	9	262	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119351	GH18_chitolectin_chitotriosidase	4.04e-30	42	290	29	278	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK48241.1|CBM18|GH18	2.49e-225	1	424	1	425
BAE63426.1|CBM18|GH18	5.14e-222	3	424	4	427
UDD62778.1|CBM18|GH18	5.14e-222	3	424	4	427
QRD94346.1|CBM18|GH18	2.09e-221	3	424	4	427
QMW33929.1|CBM18|GH18	2.09e-221	3	424	4	427

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TSB_AAA	6.29e-22	33	246	46	263	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	7.77e-22	33	246	65	282	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
5Y29_A	8.89e-17	42	278	37	277	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 [Ostrinia furnacalis],5Y2B_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with HEPTA-N-ACETYLCHITOOCTAOSE (NAG)7 [Ostrinia furnacalis]
6JAV_A	9.70e-17	42	278	37	277	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a piperidine-thienopyridine derivative [Ostrinia furnacalis],6JAW_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a napthalimide derivative [Ostrinia furnacalis],6JAX_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with chitooctaose [(GlcN)8] [Ostrinia furnacalis],6JAY_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a dipyrido-pyrimidine derivative [Ostrinia furnacalis]
1GUV_A	4.83e-16	42	255	31	257	Structure of human chitotriosidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9D7Q1|CHIT1_MOUSE	4.12e-16	42	290	52	302	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2
sp|Q13231|CHIT1_HUMAN	1.01e-14	42	255	52	278	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|P32470|CHI1_APHAL	1.14e-14	20	248	47	297	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|P20533|CHIA1_NIACI	1.11e-13	68	246	146	340	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q1E3R8|CHI1_COCIM	2.10e-13	78	292	123	341	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.300328	0.699675	CS pos: 17-18. Pr: 0.6573

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_422893-t37_1-p1.