CAZyme Information: P174DRAFT_420076-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_420076-t37_1-p1
• CAZy Family: GH154
• CAZyme Description: putative chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317		33632.00	5.6565

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000003:3985366-3986319(-)

Full Sequence      

MRHGSVLVAITATLFPSQVTAKDVPSALKAFYNKARSGGDCTGADVLQRGFHNTEWSGGH
TTYCTKYLPTGKGFYLKGPGSDLANMDIDCDGEQSRGDGRCGSSTDIQGQTRWGLKHLEK
HGVRDLNANIHPYVVLGNEGSYSPTFDPRTAGVEPLSIVAVVCGDELVYGVWGDTNGDDN
EHPMVGEASLALATACYGPRISGNSGHDEADVLYIAFAGMEAVPARAKWDADSYEAFEQS
ITAQGDQLVAQLYGDKSTATGGTDAQHTPSSSNSNSHSDHDDDNSKHNHKSGGARRSTIP
RLCHIILVASVALFGLA

Enzyme Prediction     

EC	3.2.1.132:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	12	250	4.8e-65	0.9727272727272728

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	5.50e-82	86	251	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX64743.1|GH75	3.50e-88	9	252	10	250
AFG33049.1|GH75|3.2.1.132	5.69e-87	9	252	10	250
BCR85999.1|GH75	1.63e-84	21	252	15	242
QGA18329.1|GH75	2.91e-84	5	252	4	249
UNI20522.1|GH75	1.00e-82	9	255	8	259

PDB Hits     

P174DRAFT_420076-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U3M5|CSN_ASPOR	7.79e-59	10	252	6	243	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	7.79e-59	10	252	6	243	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q4WB37|CSN_ASPFU	4.98e-53	20	252	17	240	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q875I9|CSN_ASPFM	2.76e-51	20	252	16	236	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1
sp|Q2U1H5|CSNB_ASPOR	8.45e-51	10	252	6	239	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000226	0.999750	CS pos: 21-22. Pr: 0.9784

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_420076-t37_1-p1.