CAZyme Information: P174DRAFT_419379-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_419379-t37_1-p1
• CAZy Family: GH15
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
837	MSZS01000003|CGC18	95373.99	7.2403

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000003:1873166-1875796(-)

Full Sequence      

MPSHSRSRDRYGGRDSDREARYDYDYVRRRYATDDNDDDYDDDELEHDLNERRYRRDGYR
PPRESRTRGYYERDAEGAVDEELLGDERSPHPRASRSYGDDYDARRGERSRAREAPKRGE
RHERHRDRDRDGQNRRRAYEDDGRHRTRDGRRERGRESDAEARRSRRREAGRDAAAREHQ
SSDSTNSASNLLSADALARLGAQYEKEERRKRENAKDAAKAERKRQKKRAVVGEESRALR
DPPGESHRDRTKARVASGAYLEEGRSPEMQVRHRGGGGPAMEARWRKEGSWGGSMDDAGG
RRPFWKRKRWIGLGALILILVIVIPVAVVVSKKHDNKSDPADPQGTSPGQSNLDGLSRDS
IPAYAQGTYLDPWTWYDTTDFNVTFTNETVGGLSIMGLNSTWDDSARPNDNVPPLNEPFP
YGSQPIRGVNLGGWLSIEPFIVPSLFDSYSSVAGIIDEWTLSKRLGSSAARTIEKHYATF
ITEQDFADIRDAGLDHVRIQYSYWAVATYDDDPYVAKISWRYLLRAIEYCRKYGLRVKLD
PHGIPGSQNGWNHSGREGAIGWLNGTDGELNRNRSLAVHDSVSKFFAQDRYKNIVTIYGL
VNEPLMLSLSIEDVLDWTTEATKLVQKNGITAYVALHDGFLNLSKWKSMLKNRPDKMLLD
THQYTIFNTGQIGLNHTAKVNLICNDWYNMIKEINSTSTGWGPTICGEWSQADTDCAKYL
NNVGRGTRWEGTFSLTDSTQYCPTADTGPTCSCANANADVSEYSADYKKFLQTYAEAQMS
AFETGQGWFYWTWRTESAAQWSYRTAWKNGFMPAKAYAPSFKCGDAVPDFGDLPEYY

Enzyme Prediction     

EC	3.2.1.58:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	475	796	6.1e-108	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	7.01e-41	420	813	12	382	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
273721	SF-CC1	4.51e-05	3	88	30	112	splicing factor, CC1-like family. This model represents a subfamily of RNA splicing factors including the Pad-1 protein (N. crassa), CAPER (M. musculus) and CC1.3 (H.sapiens). These proteins are characterized by an N-terminal arginine-rich, low complexity domain followed by three (or in the case of 4 H. sapiens paralogs, two) RNA recognition domains (rrm: pfam00706). These splicing factors are closely related to the U2AF splicing factor family (TIGR01642). A homologous gene from Plasmodium falciparum was identified in the course of the analysis of that genome at TIGR and was included in the seed.
395098	Cellulase	0.002	480	634	24	163	Cellulase (glycosyl hydrolase family 5).
397943	Radical_SAM	0.008	478	546	83	150	Radical SAM superfamily. Radical SAM proteins catalyze diverse reactions, including unusual methylations, isomerisation, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW27387.1|GH5_9	0.0	1	837	1	831
QMW39458.1|GH5_9	0.0	1	837	1	831
QRD81773.1|GH5_9	0.0	1	837	1	831
UDD55247.1|GH5_9	0.0	1	837	1	831
CAK45960.1|GH5_9	0.0	186	837	176	830

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2PB1_A	4.56e-74	416	824	5	398	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
1CZ1_A	7.43e-74	421	824	4	392	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
1EQP_A	7.43e-74	421	824	4	392	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	8.57e-74	416	824	4	397	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PC8_A	1.23e-73	416	824	5	398	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CHZ8|EXGD_ASPTN	0.0	1	837	1	838	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgD PE=3 SV=1
sp|B0Y7W2|EXGD_ASPFC	0.0	1	837	1	833	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgD PE=3 SV=1
sp|B8NNK9|EXGD_ASPFN	0.0	1	837	1	831	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgD PE=3 SV=1
sp|A1CTI3|EXGD_ASPCL	0.0	1	837	1	830	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgD PE=3 SV=1
sp|Q2UMV7|EXGD_ASPOR	0.0	1	837	1	831	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgD PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

Start	End
310	329