CAZyme Information: P174DRAFT_416947-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_416947-t37_1-p1
• CAZy Family: GH135
• CAZyme Description: cutinase-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350		33900.17	6.8456

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000001:3938071-3939179(-)

Full Sequence      

MKASVTTVVLLAGLAAGAPTKTIHSELEKRQFGTGTDGLGALASIFPILGGGGSSTSSGL
GALASLFPGLGGSSSSGSGFSLPGFTLPTSIPGLGSLGSLGSSGSSGASGLSGLSGLSGL
SGLNGLSASTTDSSAEASTSGTATASSDSNSGVALSGLLGDHISKRALLGSITENGVKNK
DACQPLTFIFARGTSELGNMGSIAGPPVATKLRSLLNNKVVVQGVDYPASIEGNALLGAA
GGPTMASLVKQALSQCPDTKVVVGGYSQGAMVVHNAANSLAQDQIAAAVLFGDPFKAQAV
GKVPKANVKEYCAAGDPVCLNGANVLAHLSYGDDAAEAAQFLITASGVKA

Enzyme Prediction     

No EC number prediction in P174DRAFT_416947-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	182	343	2e-43	0.9788359788359788

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	3.68e-45	182	343	1	170	Cutinase.
369775	PE-PPE	0.001	223	294	6	89	PE-PPE domain. This domain is found C terminal to the PE (pfam00934) and PPE (pfam00823) domains. The secondary structure of this domain is predicted to be a mixture of alpha helices and beta strands.
223477	YpfH	0.001	237	345	75	175	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR89623.1|CE5	3.92e-85	173	349	103	279
QQK39777.1|CE5	1.23e-83	169	350	97	278
CAP91879.1|CE5	1.53e-79	170	347	144	321
QRD85183.1|CE5	3.16e-79	163	348	145	327
BAE58644.1|CE5	1.35e-78	174	348	36	210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	7.42e-34	158	343	57	244	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
3GBS_A	2.86e-30	183	347	21	197	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	2.28e-29	183	344	12	185	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	1.23e-22	163	332	5	184	Chain A, cutinase [Malbranchea cinnamomea]
1CUF_A	1.25e-22	169	343	15	204	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8VJF5|CUTI4_EMENI	1.41e-73	168	348	45	223	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1
sp|Q00298|CUTI_BOTFU	5.48e-38	182	348	30	202	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	8.57e-36	182	347	30	200	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|A8QPD8|CUTI1_TRIHA	3.00e-35	171	342	72	243	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1
sp|Q8X1P1|CUTI_BLUHO	4.31e-35	164	343	49	233	Cutinase OS=Blumeria hordei OX=2867405 GN=CUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000520	0.999446	CS pos: 30-31. Pr: 0.6175

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_416947-t37_1-p1.