CAZyme Information: P174DRAFT_416786-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_416786-t37_1-p1
• CAZy Family: GH134
• CAZyme Description: 1-3 glucanosyltransferase Gel3p

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
526	MSZS01000001|CGC26	55738.75	4.5193

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000001:3459200-3460976(-)

Full Sequence      

MRYSLVAWVSLLSGCAIAAVPNGSKFFYANNGSEFYIRGVAYQEDYSGGGAGGTGQSDAN
YVDPLADGSKCERDIPYLLQLRTNVIRTYAVNPSLNHDACMQKLSDAGIYVITDLASPDE
SITSNSPVWTVDQYARYTSVIDAFQKYDNVIGFFAGNEVVNQANQSAGAAFVKAAARDMK
AYIKTKGYRQSLAIGYATTDNPEIRLPLSDYLNCGDQADAVDFFGYNIYEWCGDQTFQTS
GYENRTDEYKDYSIPIFFSEYGCNTEKPRKFADVPVLFGPQMDNVWSGGIVYMYFETTND
YGLVSVSGSSVTPEPDFAYLSSEMQSATPTGVNSASYSPTNSPRACPTVDDTWLAKSSPC
PRLSCVVKDSVDADKYGKLFGQVCGYGSGICDGIAHNATTGSYGAYSVCTSKDQLSYVFD
RYYKSQKKAASACDFAGAASVQSPKGESADCKSLVSQAGSAGTGTVTSQPTGGSGTTGGS
GSAASTSTSKGAAAGAVSPAAVRVGGWPFVVYGVVAAMAGVLMISL

Enzyme Prediction     

EC	2.4.1.-:3	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	22	326	1.1e-127	0.9615384615384616
CBM43	364	452	5.8e-21	0.9879518072289156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	3.50e-139	23	327	16	314	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	4.28e-30	363	440	1	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	1.68e-20	363	453	1	85	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAF40140.1|CBM43|GH72	0.0	1	526	1	554
EAL93577.1|CBM43|GH72	0.0	1	526	1	544
CAP99156.1|CBM43|GH72	8.35e-235	3	467	4	482
QQK44763.1|CBM43|GH72	1.27e-229	23	473	16	476
BCR92446.1|CBM43|GH72	8.85e-204	1	526	1	531

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	8.31e-97	23	423	40	456	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	2.32e-96	23	423	40	456	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	2.32e-96	23	423	40	456	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XT09|GEL3_ASPFC	0.0	1	526	1	547	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel3 PE=1 SV=1
sp|P0C955|GEL3_ASPFU	0.0	1	526	1	544	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel3 PE=3 SV=1
sp|B0XVI5|GEL4_ASPFC	3.24e-183	16	461	36	489	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|P0C956|GEL4_ASPFU	3.24e-183	16	461	36	489	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|P56092|EPD1_CANMA	8.67e-155	4	466	9	476	Protein EPD1 OS=Candida maltosa OX=5479 GN=EPD1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000382	0.999602	CS pos: 18-19. Pr: 0.9698

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_416786-t37_1-p1.