CAZyme Information: P174DRAFT_414101-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_414101-t37_1-p1
• CAZy Family: GH131
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421	MSZS01000010|CGC2	44809.20	8.0093

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000010:202499-203814(-)

Full Sequence      

MDGFGFSQAFGRANDLINLNADQRQYALDLLFSPTKGAGMTILRNRIGSGSGDSILPTSP
GSPNATPQYKDLGTDSNQVWVTQQAVKYGVKSIYADAWSAPGFMKTNNDQANGGYLCGVT
GANCASGDWRQAYANYLVKYIQDYAALGLQITHVGFLNEPDLKTAYSSMLSDGIQAADFI
KVLHPTMQKAGLSHVGINCCDAMGWKAQQTRTAQLISAGVEKLLSRITSHSYSSDPTSPM
GASIPVWQTENADLSDKGTWETTWYSNGGQGEGLTWAQKIYTAITQGGVSAYLYWEGFEK
DTTNSCLAITDGTNIIPSGRLWAFAQWSRFVRPGAVRVAVSGSTSTLKMTAFKNKDGTVA
VQMISSASSATPVTVKGFSARSAKAYLTDNSHNNVSGTTVSLSGGAATVNVPGYAMVTVV
L

Enzyme Prediction     

EC	3.2.1.8:3	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	1	420	1.4e-179	0.963882618510158

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227807	XynC	2.92e-16	1	370	47	400	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
396577	Glyco_hydro_59	1.42e-09	2	335	2	283	Glycosyl hydrolase family 59.
307945	Glyco_hydro_30	3.62e-09	83	194	85	197	Glycosyl hydrolase family 30 TIM-barrel domain.
407314	Glyco_hydro_30C	8.09e-09	334	419	1	63	Glycosyl hydrolase family 30 beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAO49459.1|GH30_7	1.49e-151	1	421	65	493
QRD00187.1|GH30_7	7.41e-148	1	421	39	467
QYS97800.1|GH30_7	4.61e-146	1	419	34	456
AEO57693.1|GH30_7	4.49e-144	1	390	32	435
UKZ91355.1|GH30_7	6.92e-144	1	421	38	462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M5Z_A	2.49e-135	1	421	36	453	Chain A, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	3.66e-134	1	421	16	447	Chain A, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	7.79e-133	1	421	23	454	Chain AAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6IUJ_A	6.10e-111	1	375	35	421	Chain A, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	5.00e-110	1	375	106	492	Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q1N4|XY30A_MYCTT	5.25e-134	1	421	40	471	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
sp|Q4WBR2|NEG1_ASPFU	7.74e-13	3	192	75	276	Endo-1,6-beta-D-glucanase neg1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=neg1 PE=1 SV=1
sp|Q8J0I9|GUN16_TRIHA	4.24e-11	3	193	80	279	Endo-1,6-beta-D-glucanase BGN16.3 OS=Trichoderma harzianum OX=5544 PE=1 SV=1
sp|O16580|GLCM1_CAEEL	1.30e-08	83	368	182	484	Putative glucosylceramidase 1 OS=Caenorhabditis elegans OX=6239 GN=gba-1 PE=1 SV=2
sp|Q9UB00|GLCM4_CAEEL	9.32e-08	89	364	191	482	Putative glucosylceramidase 4 OS=Caenorhabditis elegans OX=6239 GN=gba-4 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_414101-t37_1-p1.