CAZyme Information: P174DRAFT_412759-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_412759-t37_1-p1
• CAZy Family: GH13
• CAZyme Description: putative fungal chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242	MSZS01000008|CGC14	25239.73	4.0308

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000008:330614-331442(-)

Full Sequence      

MRYLTTAAVLTGAGLASAYTVPANLQQIYNKHKTGTCQNKLQDGFSDGIGGSGSFAYCGD
IEGAIFLHSSANGGQYDNMDIDCDGANNSAGDCANDPSGQSMTAFMDTVKQYGISDLDAN
IHPYVVFGNSGSSPTFDPQQYGMEPLSVMAVVCNNQLFYGVWGDTNGGTSTGEASISLAK
LCFPNDGITGDNGHGEEDVLYIGFMGQDAVPGASAAWTARDTQTFEASIKALGDRLVAKL
NA

Enzyme Prediction     

EC	3.2.1.132:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	13	238	9.3e-83	0.9545454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	4.83e-102	79	239	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJG44374.1|GH75	8.95e-162	1	242	1	242
SMR60234.1|GH75	8.60e-113	4	241	5	237
SMY28686.1|GH75	1.73e-112	4	241	5	237
SMR63344.1|GH75	1.73e-112	4	241	5	237
UKZ81671.1|GH75	3.15e-112	11	242	11	235

PDB Hits     

P174DRAFT_412759-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	5.39e-170	1	242	1	242	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U1H5|CSNB_ASPOR	2.29e-111	8	242	10	241	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q875I9|CSN_ASPFM	1.67e-103	6	242	8	238	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1
sp|Q8NK76|CSNB_ASPOZ	2.53e-103	8	242	10	240	Endo-chitosanase B OS=Aspergillus oryzae OX=5062 GN=csnB PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	4.27e-103	1	242	1	245	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000313	0.999666	CS pos: 18-19. Pr: 0.9784

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_412759-t37_1-p1.