CAZyme Information: P174DRAFT_412472-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_412472-t37_1-p1
• CAZy Family: GH13
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616	MSZS01000007|CGC10	69346.23	6.2301

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000007:2002668-2004572(-)

Full Sequence      

MQTIFSWFVILLGAAEAQQLYITTTGYPDRPQCTKPAASPEYYFHPFSYTLNETVRFATS
VPKPTTTHTYGPHYAHAVKHLSPVPATTTWGNWLPYQTVITATDTTDPYGQAAWSKLWEQ
ASIQNYTTTGLYSTTVSPTPVPSSSLVLPPADYFGPTDCYSFPDDFVFGVAGSAAQVEGA
VGLEGRSPTILEKLGNATQPKDYVTNENYYLYKQDIQRLAAIGVKYYSFSIPWTRILPFV
LPGNPVNKQGIKHYDDLINTVLDAGMLPIVTLLHFDSPWMFVAGSNFTAKPDIGYSNGGY
HNETFVDAFVNYAKIVITHFADRVPIWVTFNEPLLYALNFKGADNVVRAHAQVYHYYHDV
LKATGKMGIKFNDNFGVPRDPRNASDVHAANRFQEMQLGLFANPIFLGKQYPESILNTLP
GAKPLSKHDLSYIANTSDFFGIDPYTATVVSPAPEGIEACAVNASSKLFPYCVVQETKNG
YGWNIGYRSQSYVYITPTYLREYLNYLWNTFRSPVFVSEFGFPVFGEAEKTDLSDQLLDT
PRSIYYLSFMSEILKAIHEDGVRVMGALAWSWADNWEFGDYKQQFGLQVVNRTTQERYYK
KSFFDLVDFVSSRMSK

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	161	612	2.2e-101	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	5.69e-75	161	612	4	450	Glycosyl hydrolase family 1.
225343	BglB	1.67e-74	160	603	2	443	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	3.46e-37	161	591	27	459	beta-glucosidase
215455	PLN02849	7.03e-37	162	591	30	459	beta-glucosidase
215539	PLN02998	5.04e-35	162	591	31	464	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ28529.1|GH1	0.0	57	616	24	583
BCR83249.1|GH1	0.0	11	615	11	617
QQK40806.1|GH1	0.0	11	613	11	615
QKX60248.1|GH1	0.0	1	613	1	615
BCS23494.1|GH1	0.0	11	613	9	619

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7L74_A	3.34e-73	162	593	89	549	Chain A, Beta-hexosyltransferase [Hamamotoa singularis],7L74_B Chain B, Beta-hexosyltransferase [Hamamotoa singularis]
6M4E_A	3.34e-73	162	593	89	549	Crystal structure of a GH1 beta-glucosidase from Hamamotoa singularis [Hamamotoa singularis]
6M55_A	1.07e-72	162	593	57	517	Crystal structure of the E496A mutant of HsBglA in complex with 4-galactosyllactose [Hamamotoa singularis],6M55_D Crystal structure of the E496A mutant of HsBglA in complex with 4-galactosyllactose [Hamamotoa singularis]
6M4F_A	2.46e-72	162	593	89	549	Crystal structure of the E496A mutant of HsBglA [Hamamotoa singularis],6M4F_C Crystal structure of the E496A mutant of HsBglA [Hamamotoa singularis],6M4F_E Crystal structure of the E496A mutant of HsBglA [Hamamotoa singularis],6M4F_G Crystal structure of the E496A mutant of HsBglA [Hamamotoa singularis]
3AHZ_A	3.56e-66	160	591	10	447	Crystal structure of beta-glucosidase from termite Neotermes koshunensis in complex with Tris [Neotermes koshunensis],3VIF_A Crystal structure of beta-glucosidase from termite Neotermes koshunensis in complex with gluconolactone [Neotermes koshunensis],3VIG_A Crystal structure of beta-glucosidase from termite Neotermes koshunensis in complex with 1-deoxynojirimycin [Neotermes koshunensis],3VIH_A Crystal structure of beta-glucosidase from termite Neotermes koshunensis in complex with glycerol [Neotermes koshunensis],3VII_A Crystal structure of beta-glucosidase from termite Neotermes koshunensis in complex with Bis-Tris [Neotermes koshunensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW5|BGL1A_PHACH	2.04e-63	163	602	7	448	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q25BW4|BGL1B_PHACH	2.32e-57	163	602	12	463	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q339X2|BGL34_ORYSJ	8.75e-56	161	602	37	498	Beta-glucosidase 34 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU34 PE=2 SV=1
sp|Q5N863|BGL04_ORYSJ	1.80e-54	162	591	15	451	Beta-glucosidase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU4 PE=2 SV=1
sp|Q7EXZ4|BGL28_ORYSJ	4.82e-53	155	610	24	498	Beta-glucosidase 28 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU28 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000239	0.999700	CS pos: 17-18. Pr: 0.9745

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_412472-t37_1-p1.