CAZyme Information: P174DRAFT_397293-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_397293-t37_1-p1
• CAZy Family: GH1
• CAZyme Description: putative aryl-alcohol dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603	MSZS01000011|CGC3	65942.37	6.0734

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000011:347829-349694(+)

Full Sequence      

MDEYDYIIVGAGIGGLVLANRLSADASVNVLIIEAGANRMGDPRIDTPGFLGMLYGNPDF
DWDYTSVPQPHVNNRQIAQPRGRVVGGSTAMNFSVVMYPPASDFEAWKALGNNGWGAEDM
APYLRKFHTFSPPSKITAELLRIDRYMDANSQGCDGPVPVSLPDVYGPFNKAWDETFEKL
GWRTDADPIAGRKLGAFTAPLTVDAKTGKRGYAAAYYSPEVAARPNLRLLAETMVERVLL
TKQDGDVVATGVHIKNKDGRREIIRAKKEVILCAGSLNTPQVLELSGIGNAELLQKHGIP
VIINNPGVGENLQDHCISSISYEIADGQVSGDILRNPDVVQALIKLYEETRGGPLAGMPI
SVAYLPFVDGQGVVPRQEVEDLLARYLNSDNSLPPRLQAQYAHLRKAILDNDTPSSQYLF
LPAQLHMKPGATSMADVLAKPLPENYISIMILHNHPFSRGSVHIASSKAEDKPIYDPKLL
SHPLDLEILARHTQFLDKIVATEPLKSLLKERRIPESASDLADLDRAKEVVKERLFTCFH
PAGTCAMLPRQMGGVVDDQLKVYGTRNLRVVDASVFPLEPAGNIQATVYAIAERAADLII
GRN

Enzyme Prediction     

No EC number prediction in P174DRAFT_397293-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	600	3.7e-181	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.81e-109	3	603	7	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.48e-102	1	602	3	534	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.33e-37	456	595	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.10e-35	72	315	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	8.86e-28	4	588	56	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR96633.1|AA3_2	2.15e-315	1	601	4	607
CAK96255.1|AA3_2	5.04e-314	1	601	4	607
UDD56791.1|AA3_2	5.02e-289	2	599	6	606
QMW28733.1|AA3_2	4.10e-288	2	599	6	606
QRD83267.1|AA3_2	4.10e-288	2	599	6	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	2.08e-79	2	599	4	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	3.21e-79	4	599	6	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6O9N_A	1.13e-67	2	600	34	639	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
5OC1_A	4.16e-67	3	599	1	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.00e-66	3	599	2	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	7.15e-120	5	600	15	617	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	1.19e-114	4	599	14	608	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.19e-114	4	599	14	608	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	7.27e-86	5	599	41	629	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	3.96e-83	3	601	46	617	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.992364	0.007645

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_397293-t37_1-p1.