CAZyme Information: P174DRAFT_397213-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_397213-t37_1-p1
• CAZy Family: GH1
• CAZyme Description: FAD-binding domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509		56796.73	4.8989

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000011:171938-173670(-)

Full Sequence      

MRRFFWWLELATVPTIATALRSSSVIEQRSSASFSLTPATISTELGRKLSANSSIFCQND
PRWFNATERWQAYSQPDFLVVVEPAKESDIPIIVKYANSHGIPFLARNRGHGSTETLGRL
KNGIEISMAQLTDIKIADDKASAFFGGGVWDGQVIDALWAEGFVTGTGSCACVGVMGPGL
GGGHGRYQGFYGLIIDGLISMNVVLADGSAITVSNTSHPDLWWAMRGAGHNFGIVTSFHA
EIHKRTVDEWYITEFVFTQDQLESVFEILNSQQQNGGQPKELMNYGVFTWAAEFSTTEVS
PILEFFIHYVGSAEEAAPYLKPFQDLNPLYSNGQYYAYPDVLDATGTGMNSPMCQDGHTN
MQFPFGLLEHNITATRQIYDYFRNVTTSQPLYNQSIVVFEAYSLEGVKAVDPASTAFPHR
EDNILCDVLVTYDPDSSLDAEAIAIGKQITQFWADGQPHRQQHTYVNYAFGDEPLEQMYG
YEPWRLKKLRAAKAKYDPHNAFRFYNPIV

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	68	268	6.8e-44	0.4344978165938865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	1.26e-16	79	507	33	452	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	1.89e-15	79	214	2	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	4.78e-06	464	508	1	44	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	8.05e-04	79	261	66	262	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC87672.1|AA7	3.32e-19	51	504	43	491
QRC92907.1|AA7	2.48e-18	5	502	4	484
QKD58946.1|AA7	3.34e-18	8	503	6	486
AAS79317.1|AA7|1.1.3.-	6.05e-18	77	502	61	489
CDR44461.1|AA7	8.72e-18	1	245	1	238

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EO4_A	2.42e-21	82	504	52	464	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6EO5_A	4.34e-21	82	504	52	464	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
6FYD_A	1.27e-20	89	503	56	454	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYG_A	1.71e-20	89	503	56	454	The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_B The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_C The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_D The crystal structure of EncM V135T mutant [Streptomyces maritimus]
6FYE_A	2.29e-20	89	503	56	454	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G4N287|OXR2_MAGO7	1.29e-139	10	508	15	519	FAD-linked oxidoreductase OXR2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=OXR2 PE=2 SV=1
sp|G9N4A4|VIRI_HYPVG	2.14e-118	36	509	39	508	FAD-linked oxidoreductase virI OS=Hypocrea virens (strain Gv29-8 / FGSC 10586) OX=413071 GN=virI PE=3 SV=1
sp|A0A1J0KJK5|IACH_PESFW	3.60e-117	40	509	44	508	FAD-linked oxidoreductase iacH OS=Pestalotiopsis fici (strain W106-1 / CGMCC3.15140) OX=1229662 GN=iacH PE=1 SV=1
sp|B6HLP5|CHYH_PENRW	2.05e-100	44	508	36	499	FAD-linked oxidoreductase chyH OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=chyH PE=3 SV=1
sp|I1S3L1|CHRY5_GIBZE	3.81e-99	45	508	31	505	FAD-linked oxidoreductase chry5 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chry5 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.427392	0.572595	CS pos: 19-20. Pr: 0.5357

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_397213-t37_1-p1.