CAZyme Information: P174DRAFT_395263-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_395263-t37_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
494	MSZS01000007|CGC12	56158.22	6.4081

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000007:2108941-2110487(-)

Full Sequence      

MQPRVLTAAFRGTFSFADRISEYWKSWPKKRQKHALVVIVTVFMFCLGLKLGSDLFYAHY
WDRATISSFPNTPYVDYWEWETTSRFSNAHGTNETQENSGGDDLCDSFPSYHLSRVQVVL
KIGSTEPPNRVDTHLATVTRCITNLIVVSDHESEINGHHVHDILATLPESFWGNSPDFQA
YSALQRGEVETVGGSQGWTLDKYKFLPMVERAYEMNPTAQWFVFIESDTYVVWDNVFRLL
DQFDPSVPLYFGSPSPGKDGSFFGYGGAGFVLSTAAVQRLVARMAESNGVYSQPSLSQRY
KGLIDKDCCGDSILGWALYQSGVKLSGMWPMFNPHPVHGVPFNENHWCQPVISMHKLSLE
DMAGLARWENQRDRKLPLLYADLFEYTKLGAIDYKTDWDNGDWGGWQEPPESPGHKSVEA
CAEACHEHPQCFSYTYVHSGRCVFVPSMRLGAQKPATEDTTLSAGWDLKKIKQFRDTHKC
QRPQWVKPSTDRIF

Enzyme Prediction     

No EC number prediction in P174DRAFT_395263-t37_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	1.51e-06	215	280	81	159	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
215605	PLN03153	0.003	217	273	209	270	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10791.1|GT31	2.45e-207	23	494	12	481
BCR98451.1|GT31	2.45e-207	23	494	12	481
UDD57328.1|GT31	4.93e-206	76	494	54	477
QRD83812.1|GT31	5.70e-205	76	494	54	477
QMW32351.1|GT31	5.70e-205	76	494	54	477

PDB Hits     

P174DRAFT_395263-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9NS00|C1GLT_HUMAN	4.70e-06	219	281	162	224	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=C1GALT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999993	0.000045

TMHMM  Annotations     

Start	End
35	57