CAZyme Information: P174DRAFT_393479-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_393479-t37_1-p1
• CAZy Family: CE5
• CAZyme Description: putative exopolygalacturonase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
440		47893.72	6.4902

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000006:1665236-1666558(-)

Full Sequence      

MLITNPALLGILASLAPLALGAPSQSIQTRSRKCVIPSSYASPQGTADDSPAVASAFAQC
AENSVIIFQEGVDYNIFHPIKATNLSNVEIRVLGNLHLPQNITAVQNIVKSGQNTWFTFQ
GPRVDWTGAEDINNGWINSYGQAWWDANPANSSSFPNRPHLMSYKTSQASIKNFRSRKPI
AWNVKLHGDDITVTHAIVDAKSTGGFPFNTDGFDVEGTNISITDSIMYNGDDAIAVGSPS
HNIVFARNTIGYQSHGMSIGSLGKDPTDFANITNVRFEDVTVIDALYAARFKSWSGGKGL
VKNVVWKNIRVFNVTFPIFVTQSYSDQSASRAGTIDPSSSVMMEDFTWSDFSGSINTFHP
GDGSCVTDPCWYNAGLPNLKHTEAIVLECNTESSCKNFRTENIRLHPQSMDSPSVICMKA
TAQLNPKLGFECKNGTFVPQ

Enzyme Prediction     

EC	3.2.1.67:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	58	422	3.9e-50	0.9661538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	6.28e-34	120	401	42	318	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	5.17e-23	41	354	75	381	polygalacturonase ADPG
215540	PLN03010	7.34e-23	41	417	54	386	polygalacturonase
215426	PLN02793	4.54e-22	24	440	42	432	Probable polygalacturonase
178580	PLN03003	8.09e-19	45	370	35	347	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACQ03715.1|GH28	5.21e-309	1	439	3	441
BCS06604.1|GH28	5.00e-249	21	439	19	437
BCR93993.1|GH28	5.00e-249	21	439	19	437
ABD14402.1|GH28	5.81e-248	21	439	19	437
ABD61565.1|GH28|3.2.1.67	3.90e-246	21	439	19	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	9.25e-19	22	393	8	376	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1K5C_A	1.55e-12	117	341	61	278	Endopolygalacturonase I from Stereum purpureum at 0.96 A resolution [Chondrostereum purpureum],1KCC_A Endopolygalacturonase I from Stereum purpureum complexed with a galacturonate at 1.00 A resolution. [Chondrostereum purpureum],1KCD_A Endopolygalacturonase I from Stereum purpureum complexed with two galacturonate at 1.15 A resolution. [Chondrostereum purpureum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1D7I1|PGXC_NEOFI	3.00e-317	1	440	1	440	Probable exopolygalacturonase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgxC PE=3 SV=1
sp|Q4WX94|PGXC_ASPFU	1.48e-310	1	439	1	439	Probable exopolygalacturonase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pgxC PE=3 SV=1
sp|B0XYC4|PGXC_ASPFC	2.99e-310	1	439	1	439	Probable exopolygalacturonase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pgxC PE=3 SV=1
sp|Q27UB0|PGXC_ASPNG	6.93e-247	21	439	19	437	Exopolygalacturonase C OS=Aspergillus niger OX=5061 GN=pgxC PE=2 SV=1
sp|A2QEW2|PGXC_ASPNC	6.93e-247	21	439	19	437	Probable exopolygalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgxC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000357	0.999631	CS pos: 21-22. Pr: 0.9823

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_393479-t37_1-p1.