CAZyme Information: P174DRAFT_386368-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_386368-t37_1-p1
• CAZy Family: CE16
• CAZyme Description: putative glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
884		97070.74	6.3499

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000003:937752-940577(+)

Full Sequence      

MQVESESSVPEMGDLKTAKAAVDEVSDSSRAGTPSSQDESTREDAARSVQPNFISLLPQL
TLEEKVDLLSGTDFVHSSGVSRLNIPPLKLVDSVNGVKGSELHHGVPTTIFPSSTLYGAT
WNSTLMEELGRALAHQAKLKSAQVILGPTINIHRDPRGGRNFECFSEDPLLSGQLAAGIV
RGIQSQGVAACPKHFACNESEFKRREYSVAQSHNGRAVREIYLAAFQEMLRRSGPHGLMV
SYNKLNGTHTTEHPFLKEILRDEWAYNGCLVSDWFATKSCAASINAGLDLEMPGPSVFRG
SKLAAAVRDGLVDEKAVDECVSRVLALVEKTRESHSQEPERSEVSPDTNALALKIASEGI
VLLKNEQGVLPLDMRRAPKIAVIGVPAIEPVVSGGGSASAPPQYLQKPLDCLRDAHPFPS
LVKYTRGVNTNRIVPVVPLDCTTSKNGSPGFDVAYFNEGSNIPVYTEHQKTPMVAMVRNL
KPGLIEPGFSYEISTTITPKTTGPHTLAARVTGSFSLFVESKAVLSVSKQHEVTMEDFLF
EPARLEHRISVFMEAGKPYLVRLLSQARIPRRNDYEPTPHGATLCYEEFSDERALIAEAV
QAASSADVSIVFAGRNQQYESEGFDLDSMNISEPQVRLIRAVTAVSKKTVLVLNCGNPID
VSPFVNEVDAILNAHFPGQEGGQAIANILTGKTNPSGRLATTWPKKLDEEHVPTYHNFPA
QLTERGYEIKYEEGLQIGYRHPQSQRTAQWQFGHGLSYTTFEYSGLTVSGQEITEDARAS
DLRISVRVKNTGIYPGHEVVQLYISPPGSTKVWRPARELKGYAKVWILPGESETVTISLN
KKHAFSYWDEDAKQWRLEPGIYCLLVGPFSTPFEIEHNLVWTGR

Enzyme Prediction     

No EC number prediction in P174DRAFT_386368-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	79	293	1.5e-60	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.20e-73	81	867	100	751	beta-glucosidase BglX.
224389	BglX	4.11e-65	39	417	16	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	9.39e-53	44	879	44	775	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	1.98e-52	558	739	43	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.40e-37	81	327	62	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI65540.1|GH3	3.11e-267	48	881	6	832
CZS83194.1|GH3	3.29e-260	55	875	5	820
QKD60029.1|GH3	2.13e-258	57	867	7	812
CEF85991.1|GH3	1.21e-257	55	875	5	820
QPC60756.1|GH3	3.91e-256	55	875	5	820

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	4.90e-135	56	883	9	844	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.28e-131	56	883	9	844	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.14e-126	56	879	8	666	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.16e-111	60	870	12	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	6.34e-95	56	876	7	708	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DNN8|BGLJ_NEOFI	6.19e-156	56	883	17	863	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|P27034|BGLS_RHIRD	1.44e-154	56	866	5	795	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	5.14e-154	57	883	10	838	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q2U8Y5|BGLI_ASPOR	1.02e-153	57	883	10	838	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.95e-153	49	883	2	837	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_386368-t37_1-p1.