CAZyme Information: P174DRAFT_385940-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_385940-t37_1-p1
• CAZy Family: CE16
• CAZyme Description: putative glucooligosaccharide oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	MSZS01000003|CGC5	51454.17	4.8470

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000003:289987-291489(+)

Full Sequence      

MGNTTSIAAGRDCLLSAVGGNHAHVAFQDQLLYQVTAVEPYNLNIPVTPAAVTYPQSADE
IAAVVKCASEYGYKVQARSGGHSFGNYGLGGEDGAIVVEMKHFNQFSMDESTYTATIGPG
ITLGDLDTALYNAGHRAMAHGICPTIRTGGHLTMGGLGPTARQWGLALDHVEEVEVVLAN
SSIVRASNTQNQDILFAIKGAAASFGIVTEFKVRTEAAPGVAVQYSFTFNLGTPAEKAKL
VKDWQAFIAQEDLTWKFYSNMNIFDGQIILEGIYFGSKEEYDALGLEKRFPSSEAGTVLV
LTDWLGMVGHGLEDVILRLVGNTPTWFYAKSLGFTPRALIPDSAIDEFLNYIHENTPGTV
SWFVTLSLEGGAINKVPGDATAYGHRDVLFWVQIFMINPLGPVSQTTYGFADGLYDVLAK
AVPNSAGHAYLGCPDPRMPNAQQAYWRSNLPRLEELKGELDPKDIFHNPQGVMVVS

Enzyme Prediction     

No EC number prediction in P174DRAFT_385940-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	40	256	6.8e-72	0.4606986899563319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.15e-31	49	187	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	2.97e-30	46	472	29	456	FAD/FMN-containing dehydrogenase [Energy production and conversion].
215242	PLN02441	3.33e-13	47	219	63	242	cytokinin dehydrogenase
369658	BBE	7.99e-11	429	472	1	44	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
178402	PLN02805	2.61e-08	49	223	134	312	D-lactate dehydrogenase [cytochrome]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW42271.1|AA7	4.05e-282	1	473	1	472
QMW30198.1|AA7	2.34e-281	1	473	1	472
QRD86662.1|AA7	3.27e-281	1	473	10	481
UDD61931.1|AA7	2.72e-280	1	473	1	472
CAK49173.1|AA7	1.96e-268	1	473	1	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ZR6_A	7.44e-72	41	476	35	480	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
5K8E_A	4.89e-71	36	472	48	492	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
3RJ8_A	7.45e-71	38	476	26	473	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
3HSU_A	1.56e-70	41	476	35	480	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
6Y0R_AAA	2.50e-63	41	472	53	488	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6HNK6|SORD_PENRW	7.95e-111	13	476	10	471	FAD-linked oxidoreductase sorD OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=sorD PE=3 SV=1
sp|Q6PW77|GOOX_SARSR	3.47e-71	41	476	54	499	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|G2QG48|XYLO_MYCTT	2.52e-70	36	472	48	492	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	6.61e-70	38	476	48	495	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|I1S2K2|CHITO_GIBZE	1.29e-62	41	472	53	488	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_385940-t37_1-p1.