CAZyme Information: P174DRAFT_385934-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_385934-t37_1-p1
• CAZy Family: CE16
• CAZyme Description: pectin lyase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		43990.63	4.6580

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000003:279499-280909(+)

Full Sequence      

MKLSAPLLVSLAAFSQAVTALVAFPGAEGFGANAIGGRKGQVYVVTNLNDSGEGSLRDAV
SATDRIVVFAVGGVIKISERIVVSKRVTILGQTAPGDGITVYGNGWSFSNADDAIVRYIR
IRMGKGGSSGKDAMGIAEGTRMIFDHISVSWGRDETFSINGDASNITVQNSIIAQGLETH
SCGGLIQTDGGVSLFRNLYIDNKTRNPKVKGVNEFTNNVVYNWGGGGGYIAGDSDGQSYA
NIIGNYFISGPSTSVTAFTRGNANFHGYVDNNYYDSDKDGTLDGSELGVSSSNYGGMAIV
SSKYNYPAVAYTMSPAEAVTYVTKYAGASKVRDSVDTQLIAQVQSWGTKGALISDEATMG
GPGTLNGGTPAKDTDGDGIPDEAETQLGTDPNTNDSMKLHSSGYTYLEVWANSLVPSSYN

Enzyme Prediction     

No EC number prediction in P174DRAFT_385934-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	72	247	1.6e-54	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226384	PelB	5.25e-07	7	331	14	344	Pectate lyase [Carbohydrate transport and metabolism].
408654	TSP3_bac	1.24e-05	373	392	1	20	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP91803.1|PL1_2	1.21e-285	1	420	1	420
QMW43898.1|PL1_2	2.60e-243	6	419	5	418
QRD90936.1|PL1_2	7.43e-243	6	419	5	418
QMW31873.1|PL1_2	7.43e-243	6	419	5	418
UDD60834.1|PL1_2	3.51e-241	6	419	5	418

PDB Hits     

P174DRAFT_385934-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DPF0|PLYC_NEOFI	1.27e-294	1	420	1	420	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
sp|B0XMA2|PLYC_ASPFC	6.46e-288	1	420	1	420	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
sp|Q4WL88|PLYC_ASPFU	9.17e-288	1	420	1	420	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
sp|Q0CLG7|PLYC_ASPTN	1.59e-251	8	420	7	419	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
sp|B8NQQ7|PLYC_ASPFN	1.32e-243	6	419	5	418	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000514	0.999451	CS pos: 20-21. Pr: 0.6719

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_385934-t37_1-p1.