CAZyme Information: P174DRAFT_378739-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_378739-t37_1-p1
• CAZy Family: CBM21
• CAZyme Description: glycosyl hydrolase family 76 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456	MSZS01000010|CGC9	50403.83	4.5822

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000010:107452-109003(+)

Full Sequence      

MRMLSLRQLCGATTLLLSGQVALAELGIQADNVDSLKSAAKTVAAPMMEFYDKNQTEGIP
GKLTGTWYVAGAMFMTLIQYWQASGDDTYNSVVSHDLMFQSGENYDFFSGNYSQWLGNDD
QMFWGLASITASETGFPELSDKPTWTSLARVVFNMQVARWDQVACDGGMRWQIWPYQAGY
TMKNAISNGGLFELSARLARFTRNDTYAQWADKIWDWSASTPLLQMDRWYIADSTSNEAN
CKDAGNTQWSYNYGTYLSGASFMYNYTNGEDKWLKRVNGLLDSLIGTFCPKDKGGNILSE
VACEPIMTCDRNQVGFKGYTAMWLAHTAILVPSTAARIFPVLQGSALAISKQCSKAPDNT
CGIRWWQPTWDGFTPGLESQMAALAGITANLMYYKSSAPNTIQTNPEGKEHQIDTHEDEA
PDALDPINTGDRAGAWILTVIIVVAVGGSVGWLIKT

Enzyme Prediction     

No EC number prediction in P174DRAFT_378739-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	29	400	1.1e-96	0.9636871508379888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	3.78e-178	35	384	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW48345.1|GH76	2.85e-252	1	456	1	457
QRD92720.1|GH76	2.85e-252	1	456	1	457
QMW36289.1|GH76	2.85e-252	1	456	1	457
UDD65548.1|GH76	2.85e-252	1	456	1	457
BAE66452.1|GH76	4.04e-252	1	456	1	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	2.68e-83	31	432	31	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74556|YCZ2_SCHPO	3.31e-90	26	392	20	385	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q6FLP9|DCW1_CANGA	4.58e-88	16	454	6	445	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	2.15e-87	28	454	21	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|P36091|DCW1_YEAST	3.07e-86	31	454	27	448	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q9P6I3|YHG7_SCHPO	7.80e-85	34	439	28	426	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000667	0.999318	CS pos: 24-25. Pr: 0.9733

TMHMM  Annotations     

Start	End
432	454