CAZyme Information: P174DRAFT_377040-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_377040-t37_1-p1
• CAZy Family: PL9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		42762.47	6.1463

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000008:265558-266745(+)

Full Sequence      

MHSDSPSSSSVLRWLRAQCSRRRYQCAFGAAILMLLLFHFHTTVVPMESSSRLTSHFSKP
SMAREVSASSLLSRPISKDPVTIPKIIHQTWFPAGSNMSEQAQSWVHTMREQNPDWEWVL
WDDETNNLLVQTYFPWFWDIYSGLPKEILRADLVRNFYMYLFGGMYADVDTEALIPVEQL
FIGHGTSVASHHKTLSSSPPSESSLVQRAFMGRMSHSDDLMASAAVPNGWMASPPGHPFW
LMNIIFLMEHPEGTGDGSVEGLTGPGVLSLMIKHYYENFKNESLRQHVCDRVQQRQPSWS
IFCGDEYVHNEKLRDALILLPRQQIYPYSWADDRDSVCLAAHDNPLFDADECKRIMDVDA
WPSYFITYCTHSW

Enzyme Prediction     

No EC number prediction in P174DRAFT_377040-t37_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	8.19e-20	33	293	36	261	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.53e-11	103	180	9	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65556.1|GT32	6.27e-169	20	373	11	362
QRD92713.1|GT32	8.90e-169	20	373	11	362
QMW36295.1|GT32	8.90e-169	20	373	11	362
QMW48351.1|GT32	8.90e-169	20	373	11	362
BCS10897.1|GT32	8.94e-164	5	373	5	371

PDB Hits     

P174DRAFT_377040-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	1.82e-16	77	170	51	142	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.52e-14	76	170	76	167	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P38287|CSH1_YEAST	1.12e-13	80	275	59	223	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.63e-12	80	275	52	216	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q5A4E3|OCH1_CANAL	4.19e-09	84	342	100	369	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000011

TMHMM  Annotations     

Start	End
26	45