CAZyme Information: P174DRAFT_372364-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_372364-t37_1-p1
• CAZy Family: AA7
• CAZyme Description: GPI mannosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438		48292.90	9.4372

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000005:1039595-1041116(-)

Full Sequence      

MTSPSRRAGSQSACSLCPILVNPRRPLRSLSILFGLWKALIFLVIAFCPGLGYDTSTSVL
LYPTRDLSDVDPLHFPLPLRFVRWDSIYFVHAAEHGYVFEQEWAFGYGYTRLLALLAPVL
VLYRLSISIFGGDTAKQKTLCFLSAALHIISPAGAFLSAPYGEALFSLLSISGFYLYSSS
VLDDTTNHRLSLDLKLLTAAVLISAATAVRSNGILGGILFAYDALLQLRQILSRGLAWAV
VSRLVVIVLGGCVIALGMAVPQYIAFNAFCMNPNAPRPWCGWTIPSIYRFVQEQYWNVGF
LRYWVVPNIPLFLLALPMLALLLRSALWAWRLPSITSKFSKNGANGASTKAMWLLPRLAI
IQALLAVLAFTSYHVQIINRLSSGYPLWYWHLAAELISDLEDSQSTNKGISISAVAIQAM
MIYGLIQAVLFGSFLPPA

Enzyme Prediction     

No EC number prediction in P174DRAFT_372364-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	113	438	5.8e-87	0.7248157248157249

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	4.59e-30	30	438	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	8.57e-14	123	438	135	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS01167.1|GT76	1.85e-167	18	438	13	469
BCS12914.1|GT76	1.85e-167	18	438	13	469
CAK38795.1|GT76	3.36e-167	18	438	13	466
BCR82784.1|GT76	6.55e-162	18	438	12	465
BAE58188.1|GT76	4.89e-159	18	438	10	434

PDB Hits     

P174DRAFT_372364-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WQ21|GPI18_ASPFU	1.88e-283	1	438	4	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	8.70e-160	18	438	10	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	3.21e-83	25	438	9	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	1.23e-82	26	438	18	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	9.03e-47	53	438	29	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999952	0.000062

TMHMM  Annotations     

Start	End
31	53
105	127
140	162
200	222
244	266
310	332
353	375
414	436