CAZyme Information: P174DRAFT_362415-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_362415-t37_1-p1
• CAZy Family: AA3
• CAZyme Description: family 2 putative glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604		67923.20	4.8769

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000001:3965330-3967480(+)

Full Sequence      

MTLKSVVIIIMLGRRQIGTNPWPEYPRPQLERSEWQNLNGIWQYQNAPGLEAVQAPPFGQ
ALTNEVLIPSCLESALSGIQGNHTLYSWLSTTFTIPKGWKHQNVLLNFGAVDYEATVFVN
GKQAGFNRGGYSSFTLDITQFVSFDGANELLVFVHDPTDSGDYVIPIGKQRLIPAHIFYT
PCSGIWQSVWIESAPANYIAELDISAGMDGQEVNVTALSASGESTAVDVTVFDGGSDKQV
ASHKGTSDQPFSFKVESPKLWSPDSPTLYNISVKMGADEVKSYTGFRTISKGTVNGILRP
LINGEFTFVFGTLDQGYWPDGIYTPPNREAMVYDLHFLKSLGFNMLRKHIKVEPALFYRA
CDEIGLLVIQDMPSPRPLQSRKLPNCNDQTILPDAAQQEEFNRQLELLVKQHRSYPSIFS
WVIYNEGWGQRTDYYPEIELTERVRQLDPTRLVDATSGWIDHGHGDFSDNHHYSYPQCGA
PFYSIQSSPHDPSRLAIQGEFGGVGTNVSIEHLWNDIDAINGINQTYEIADNFDIWNYRS
HLLLSELKDQITRFSCSGGIWTQTTDVEGEVNGLLTYDRRLKRVDEKMWKDDIQALYDAA
KART

Enzyme Prediction     

EC	3.2.1.146:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	30	477	5.1e-99	0.5066489361702128

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236657	PRK10150	1.12e-34	27	453	3	445	beta-D-glucuronidase; Provisional
225789	LacZ	1.39e-32	28	483	6	491	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236673	ebgA	5.65e-22	33	467	39	478	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	2.50e-13	87	195	67	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
236548	lacZ	6.15e-11	183	453	207	485	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAL93747.2|GH2	0.0	16	604	50	637
BCR88823.1|GH2	0.0	17	603	50	634
BCR96616.1|GH2	0.0	17	604	49	633
BCS09120.1|GH2	0.0	17	604	49	633
BAE58640.1|GH2	0.0	18	603	65	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	9.12e-116	23	591	27	577	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6XXW_A	7.14e-23	25	453	23	444	Structure of beta-D-Glucuronidase for Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6D50_A	1.13e-21	28	426	28	426	Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
5UJ6_A	1.48e-21	36	426	28	418	Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D8G_A	1.49e-21	28	426	28	426	D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii],6D8G_B D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KM09|PLH16_FORAG	5.97e-25	88	458	109	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|T2KPJ7|PLH8_FORAG	1.11e-23	22	546	40	576	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	1.43e-19	82	451	53	410	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|A1SWB8|BGAL_PSYIN	1.02e-15	93	461	126	491	Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=lacZ PE=3 SV=1
sp|P24131|BGAL_CLOAT	1.25e-15	36	581	47	601	Beta-galactosidase OS=Clostridium acetobutylicum OX=1488 GN=cbgA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.242441	0.757550	CS pos: 19-20. Pr: 0.6261

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_362415-t37_1-p1.