CAZyme Information: P174DRAFT_339894-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_339894-t37_1-p1
• CAZy Family: AA14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244	MSZS01000016|CGC2	28405.78	6.9641

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000016:104096-104827(-)

Full Sequence      

TTKIPRIIHQTYKSANIPSNWIETSESCKEMNPSYTHFLWTDITAREFIYRNYPWFLPIY
DSYPYPIQRADAIRYLVLQHFGGVYIDLDVGCRRCLDPLLNSSIWFPQTRPYGVSNDVMA
SIPGHPLMMKLVLDLVDRHVSYLPPYLAVFWTTGPLYVNDILASWLQYISIGMNADVTDH
SINIFPLKQARDSDLVILPPEFYDRTEYSFFRHVPGSSWHGPDAVLMKWIFRHLGKLSLL
LLSL

Enzyme Prediction     

No EC number prediction in P174DRAFT_339894-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	21	102	1.7e-22	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.05e-50	2	234	80	295	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	5.96e-24	18	100	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UCK58225.1|GT32	1.01e-87	4	233	71	288
QRD88228.1|GT32	2.12e-87	4	233	95	312
BAE56144.1|GT32	2.12e-87	4	233	95	312
QMW37845.1|GT32	2.12e-87	4	233	95	312
QMW25762.1|GT32	2.12e-87	4	233	95	312

PDB Hits     

P174DRAFT_339894-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	6.03e-65	4	233	57	268	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	4.83e-64	4	234	55	266	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	5.14e-62	4	234	62	274	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	5.00e-61	4	234	82	296	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	1.22e-55	3	233	63	275	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000001

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_339894-t37_1-p1.