CAZyme Information: P174DRAFT_129096-t37_1-p1

Basic Information

• Species: Aspergillus novofumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus novofumigatus
• CAZyme ID: P174DRAFT_129096-t37_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1083	MSZS01000003|CGC28	114570.45	8.1899

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnovofumigatusIBT16806	11729	1392255	197	11532

• Gene Location: location=MSZS01000003:1359707-1362958(-)

Full Sequence      

MKGLLVASALLASCVSGHMQMSKPYPIRSPLNPDADDQKDYSYTNPLSTDGSDYPCKGYA
NDPFKSVADYTAGQTYELELQGSATHGGGSCQIALSYDEGKTFKVIHSMLGGCPLTSKYN
FQIPSDAPSGEALLAWSWFNKIGNREMYMNCAMVTIKGGSQARQHARDLSPAFSRRAGGF
DSLPPLFEANINGPGKCKTVEGQEVNFPLPGPSVEGSLSGKGYQCESDAPFLGSDSSSNS
PKASSSDQAVASTATSSSAQSPAASSTAQSPATSQSKATSSSSQSPATRSSSHPVVKPSS
SHPVVKPSSSQSPATPSGSHSVATPSARPARLHAPLRERPKPSQSSSPDFMYNAQPKSQS
TAESGYMPQSPSSPESGYMPESQTSPEFAYNPQSASQSIPQSGYTPPSASQSTGNSGYKP
ETQSSPEFGYNAQSASQSIPQSGYQPEIQSNPEFEYNPQSASQAAPQSGYSPQSSSQASP
QSGYKPQPSSQYIPESGYKPESQSSPEFEYNPQSASQATPQSGYKPQPSSQSLPESGYKP
ETQSSPEFGYNPQSTSQSIPQSGYQPEIQSNPESGYSPQSSSQATPQSGFKPQSSSHATP
QTGYQPESQSNPESGYNPQSASQAAPQSGYSSQSSSQASPQSGYKPQSSSHATPQTGYQP
ESQSNPESGYNPQSASQSIPQSGYMPQSAASQSTPEFGYSPQSSSSQASPQTGYQPESQF
NQDSGYSPQSASQAPQSLRTSLSLLSPLRNLDTSLSRCLKPPQTLDISLSLVNPLRKLGT
SLSHLSWRLKPPQTLSTTLSPHLKRPLSLDISLSHPNLVNLPQTLGTSPSLLSLGTSPSL
LKWLLSLDTSLSPPSLVNLPQTLGTSLSLLSLDTSLSPPSLVNLPQTLGTSPSLLKWLLS
LDTSLSPPSLVSLPQTLGTSLSLLSPLLSLGTSLRLSLSPSPSLGISLRQSLHPNLSPRT
TPKQNTPLSPSLPPRLRPRKNSRRLANTARSCAGPMVRHGRSATGANLFRWDLLPPVRAA
ATVLSSVRRVVVSLPHSSIFWCMHIPSLIQVCVLVVAIREVVSVFECRSCYSLCTFCQGP
LID

Enzyme Prediction     

No EC number prediction in P174DRAFT_129096-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	18	216	1.7e-67	0.9633507853403142

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223021	PHA03247	7.79e-10	286	695	2580	2984	large tegument protein UL36; Provisional
223021	PHA03247	7.85e-08	267	670	2597	2999	large tegument protein UL36; Provisional
411414	MSCRAMM_ClfB	2.01e-06	340	626	554	833	MSCRAMM family adhesin clumping factor ClfB. Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.
411414	MSCRAMM_ClfB	2.97e-06	368	662	548	841	MSCRAMM family adhesin clumping factor ClfB. Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.
411414	MSCRAMM_ClfB	3.07e-06	486	734	546	784	MSCRAMM family adhesin clumping factor ClfB. Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW41394.1|AA11	1.44e-99	1	244	1	238
QMW29322.1|AA11	1.44e-99	1	244	1	238
QRD85645.1|AA11	1.44e-99	1	244	1	238
BAE59063.1|AA11	1.44e-99	1	244	1	238
UDD58751.1|AA11	1.44e-99	1	244	1	238

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	5.51e-31	18	215	1	200	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

P174DRAFT_129096-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000969	0.999027	CS pos: 13-14. Pr: 0.7919

TMHMM  Annotations     

There is no transmembrane helices in P174DRAFT_129096-t37_1-p1.