CAZyme Information: P170DRAFT_514564-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_514564-t37_1-p1
• CAZy Family: GT90
• CAZyme Description: choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566	MSFO01000011|CGC4	61961.03	5.3463

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000011:819067-821046(-)

Full Sequence      

MGSTERSFDYVICGGGTAGCVLASRLAEAANVSVLVIEAGEHNRDLKMTHMAGAFTQNFE
TSQDWCIESEPLAGNGDRRVMLNRGKFLGGSSGCNATLCVRGIKQDYDDWGVEGWSGEEM
FEYMKKAETFHGKPWFKASPDTHGNSGPLHTEPHDFAPISTLMKESCISKGPPFIDDLFA
TGEAPEGCGHVVRTVHKGIRTTAADYLQSGHIRGSITLETNAVVDRILITESYDGSYTAT
GVVYVDAQTHAPSTVRASREVVIAAGSFCSPAVLMRSGIGPRDDLASHGIDCIMDLPGIV
WIFYESEKAGLTNDCYVYHTGAMEASLKQWEEEKSGVLTHIPCGVVAYSRVDDQLKNEPL
WTESPRKQGHDPMGIRPNQPNIELLTLECYTPLKHSTDFPADNQHAFGIVPELFGARTRG
SVRLKSTDPLDNPIVDCQFLADPLDMLVMSEACRFANEIMTEGQGTKDLVKGSWPPASGH
NTWTTREQWISWIKENITTCYHPAGTCKMGRITDPLAVVDEKLRVKGIKNLRVADCSIMP
GLNSGHTQMPAYAIGEKCADMIKEWS

Enzyme Prediction     

No EC number prediction in P170DRAFT_514564-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	564	2.7e-145	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.46e-105	3	563	1	532	choline dehydrogenase; Validated
225186	BetA	1.16e-97	1	564	1	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
273814	betA	1.96e-83	9	563	1	527	choline dehydrogenase. Choline dehydrogenase catalyzes the conversion of exogenously supplied choline into the intermediate glycine betaine aldehyde, as part of a two-step oxidative reaction leading to the formation of osmoprotectant betaine. This enzymatic system can be found in both gram-positive and gram-negative bacteria. As in Escherichia coli, Staphylococcus xylosus, and Sinorhizobium meliloti, this enzyme is found associated in a transciptionally co-induced gene cluster with betaine aldehyde dehydrogenase, the second catalytic enzyme in this reaction. Other gram-positive organisms have been shown to employ a different enzymatic system, utlizing a soluable choline oxidase or type III alcohol dehydrogenase instead of choline dehydrogenase. This enzyme is a member of the GMC oxidoreductase family (pfam00732 and pfam05199), sharing a common evoluntionary origin and enzymatic reaction with alcohol dehydrogenase. Outgrouping from this model, Caulobacter crescentus shares sequence homology with choline dehydrogenase, yet other genes participating in this enzymatic reaction have not currently been identified. [Cellular processes, Adaptations to atypical conditions]
274888	Rv0697	3.56e-66	9	562	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	3.17e-37	417	558	2	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFB81353.1|AA3_2	1.13e-252	5	564	8	574
UDD65288.1|AA3_2	5.66e-252	1	566	1	575
QMW48130.1|AA3_2	9.29e-251	1	566	1	575
QMW36070.1|AA3_2	9.29e-251	1	566	1	575
BCS07163.1|AA3_2	5.54e-249	5	564	2	567

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	7.89e-71	8	563	7	570	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.10e-70	8	563	7	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.54e-70	8	563	7	570	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3NNE_A	5.02e-61	4	563	10	527	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	9.71e-61	4	563	10	527	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q39A44|BETA_BURL3	1.17e-70	4	563	2	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383) OX=482957 GN=betA PE=3 SV=1
sp|B4EHJ2|BETA_BURCJ	4.44e-70	4	563	2	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) OX=216591 GN=betA PE=3 SV=1
sp|Q1BQE2|BETA_BURCA	6.20e-70	4	563	2	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain AU 1054) OX=331271 GN=betA PE=3 SV=1
sp|B1K707|BETA_BURCC	6.20e-70	4	563	2	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain MC0-3) OX=406425 GN=betA PE=3 SV=1
sp|A0B2F7|BETA_BURCH	6.20e-70	4	563	2	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain HI2424) OX=331272 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000005

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_514564-t37_1-p1.