CAZyme Information: P170DRAFT_513126-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_513126-t37_1-p1
• CAZy Family: GT8
• CAZyme Description: alfa-L-rhamnosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
997		111670.04	5.9017

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000008:1004447-1007548(+)

Full Sequence      

MERCQDIRIRKPVPTTAEYNRRGRVLSPEETDSELLGAFTPRRRQQAVYKNNLSISHVTH
HYHPLIMIEIYDLRIARQHSALGVSAEPQIAWRYRATVKGPAGWTQTAYDIEIQRPSGSG
ETKVFRVASSTSLSESWPDQPLVSRETAALRVRAHGRTERAGGPESAASTPWSHWISIEA
GLLAREDWTASFITSALSPAPDPCDKGLRPIRLRKTFRLSSRVPLARARLYITALGLYVA
YLNGRRVGGDHMTPGYTSYHHRIQYQVYDVADLLVSGENTLGIEVAEGWYAGEIAWDNRT
RCLYGSEIGALAQLEVLEEDGIAPSLLLQSDETWESQLSPILASGIWNGELYDRRLEESD
WNRPRSEVSRWQQVKRMPFPSAELVVTSAPAVKVTQTVRPVKVFRTRSGKSVVDFGQNLV
GRVQIHGLKRPLGHRVQIRHAEALEDGELAVRPLRGARATDTLIFGQDDTVRDWSVSFTY
HGFRYAEFQGWHTQDAADPLTIDSVSALVMHTDMDRTGYFGCSDDLLNRFHENVVWSMRG
NFFSIPTDCPQRDERMGWTGDIQIFSPTAAFLYDCDGMLGNWMIDLIQDQRDSNGVVPFV
VPNCLSEWKWPALAQAIWDDVVILLPWVLYQYFGDVETLRESYSGMKIYLDSAIPRGEDG
LWDPDIWQLGNWLDPNAPPQEPGLSRTDGTLVADEYLVYVTGIMARVAGILGNPDDCARY
GADFQSLMRAFQEKYMSPSGLLVGDSQTSIALALNFNLHDTPQLQDKRSQAQDALRRRGN
AADRLVRLVQYAKFRVSTGFAGTPAILHALSSSGNLQIAYRMLLEEGCPSWLYAVKMGAT
TVWERWDSMLPDGSVNPGAMTSFNHYALGAVADWLHTVVGGLRPVADEPGWRRFIVQPRP
GGTLTNAFVELKSPCGLIRCEWRIEDGPDQIFQMDLTVPPNSTALVVLPQGNRVQNVGSE
ASDAKLVGSGSYHFECIYTSEGPWPPTARLTEFREDC

Enzyme Prediction     

EC	3.2.1.40:1	3.2.1.40:8	3.1.1.73:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	404	948	1.3e-157	0.996031746031746
CBM67	209	377	1.1e-31	0.8693181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.32e-140	515	879	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
400715	Bac_rhamnosid_N	8.96e-60	224	396	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
336149	Bac_rhamnosid	1.05e-26	405	511	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	1.27e-19	881	949	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS18429.1|GH78	0.0	85	990	22	888
EAA65188.1|GH78	0.0	88	988	638	1495
CAP83098.1|GH78	0.0	78	986	13	905
UQC81878.1|GH78	0.0	65	993	1	833
QRD82895.1|GH78	0.0	76	986	12	907

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	2.36e-246	68	977	2	868	Crystal structure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	2.22e-145	212	974	304	1028	Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	5.36e-120	71	974	33	939	Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KNB2|PLH20_FORAG	3.39e-145	86	979	53	925	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
sp|Q82PP4|RHA78_STRAW	8.39e-145	212	974	304	1028	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
sp|P9WF03|RHA78_ALTSL	1.53e-121	86	977	49	911	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
sp|T2KPL4|PLH28_FORAG	1.71e-84	228	978	200	949	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000016

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_513126-t37_1-p1.