CAZyme Information: P170DRAFT_508448-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_508448-t37_1-p1
• CAZy Family: GT61
• CAZyme Description: serine palmitoyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355	MSFO01000003|CGC6	38868.38	5.7071

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000003:1018705-1019897(+)

Full Sequence      

MNWLLHFIAVLLLSLHVGALPSGPMHGLEQRDLATENEQPSVIVYVNEIGQTLSVKTLVP
SATAPVNAPTDISSPPPASGTNVPSPDSPISLSPAAQDRFGVTYAPFNDDSTCKSQDQVN
QDMDKIARLYSFVRIYGVDCDQTRKVVQAARERNIRVFAGVFDLQNFPASLDEIIRVAAG
DWSTFHSINIGNELVNKGQNSVSDVVNAVNTARRILRSAGYQGPVVTVDTFSVLLNHPEL
CHVSDYCAANCHAFFDANMTPDRAGAYALEQSQRISAAAGGKHTVITESGWPHHGHPNGR
AVPSRENQYTAIITLSNSFGRRYNDLIFHSAFDDLWKQDTPDSFGAEKYWGLETW

Enzyme Prediction     

No EC number prediction in P170DRAFT_508448-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	101	352	2.8e-21	0.9517684887459807

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	5.17e-71	54	351	7	299	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	8.19e-06	108	352	11	296	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD89175.1|GH17	5.42e-131	1	352	1	326
UCK57248.1|GH17	5.42e-131	1	352	1	326
BCS13276.1|GH17	6.09e-131	1	352	1	360
BCS01560.1|GH17	6.09e-131	1	352	1	360
QMW24913.1|GH17	2.80e-130	1	352	1	323

PDB Hits     

P170DRAFT_508448-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	3.98e-67	101	352	128	375	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	1.56e-62	101	352	138	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	2.89e-58	101	352	135	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|A1C499|BTGE_ASPCL	3.75e-40	89	351	298	559	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1
sp|B0Y9Q9|BTGE_ASPFC	5.24e-40	95	351	304	559	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000210	0.999770	CS pos: 19-20. Pr: 0.9801

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_508448-t37_1-p1.