CAZyme Information: P170DRAFT_503157-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_503157-t37_1-p1
• CAZy Family: GT4
• CAZyme Description: putative glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604		64887.48	5.5907

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000009:946180-948105(+)

Full Sequence      

MTAKAALLALLAAFAQASPPFGSSFGVPGTNATYDYVVVGGGNAGLTLATRLVQQSAGTV
AVIEAGSFYEISNGNFSQVPAFTGASSGRELSDWHPLIDWGYATTPQAGAYNLSIHYARG
KTLGGSSARNSMVYQRGTVGTHERWADKVGDDSYRWENFHPYFKKSVNLTRPNMHLRFQN
STPVYDALAASDGNGPLSISYPNYAQAFTTWSIPGFAQIGIPEIPGFLSGEIIGHSYSTL
TINGTTMTRDSSETSFLREGLKNPNLIVYPMAMAKRILFTEEKAASGVVVEVQGLEYVLS
ARKEVLVCAGAFGSPQLLMVSGVGPAEVLKSFDIPIIADRPGVGQGMQDHVVYDIGYQVN
VPTMSSLMNPAFGAKHIQLFNEHAAGMLTGSNTEALAMEKIPESLRATWSNKTRDQLNAY
PADWPEVEYITVPLNPANSIAEPGIDYGSLGIVLVAPESRGTLTISSADTNVAPIIDPNY
FDEPSDMDILVAGFKRARQFFDTEALRTIVIGEERFPGKNVSTDAQIADFIRKNIHTIWH
ASCTCAMGKVTDPMAVVDAQARVIGVQKLRVVDSSSFALLPPGHPMSTVYALAEKIACDI
SGHC

Enzyme Prediction     

No EC number prediction in P170DRAFT_503157-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	33	600	4.8e-175	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	5.52e-108	30	602	2	533	choline dehydrogenase; Validated
225186	BetA	5.98e-93	31	603	5	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.38e-42	457	596	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.11e-33	19	589	41	565	Protein HOTHEAD
366272	GMC_oxred_N	1.97e-20	118	352	22	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA12464.1|AA3_2	1.16e-278	5	604	8	613
APA07712.1|AA3_2	2.71e-259	22	602	38	627
ATZ47873.1|AA3_2	1.80e-257	22	602	38	627
QSZ35459.1|AA3_2	3.92e-254	22	602	38	627
AUS76865.1|AA3_2	5.22e-193	5	600	8	610

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	1.11e-61	31	597	3	579	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4H7U_A	7.13e-54	34	594	41	591	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	1.38e-53	34	595	2	556	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.69e-53	32	595	1	557	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
2JBV_A	1.63e-50	34	597	14	523	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A075TRK9|PATE_PENEN	5.92e-234	22	604	41	628	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	1.94e-232	22	604	40	628	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	1.42e-176	20	597	22	604	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	2.73e-157	31	597	38	604	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q0CJ60|ATC_ASPTN	1.76e-151	21	600	33	593	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000464	0.999513	CS pos: 17-18. Pr: 0.9739

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_503157-t37_1-p1.