CAZyme Information: P170DRAFT_493134-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_493134-t37_1-p1
• CAZy Family: GT33
• CAZyme Description: putative cutinase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
213		22335.31	4.5773

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000003:3228160-3228960(+)

Full Sequence      

MKLQLLSAALAGLAAASPMALEERQASSGNELRNGDCQPVTFIFARASTEVGLLGASTGP
SVCSKLKSARSDGVACQGVGPKYRATLGDNALPKGTSQVAIDEAKELFELAAEKCPDTQI
VAGGYSQGTAVMHGAIPELSDALKDQIKGVVLFGDTRNKQDNEQIPDFPKDKIKIYCATG
DLVCEGTLIVAPPHFSYLGDTTDATEFLEGKLE

Enzyme Prediction     

EC	3.1.1.74:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	37	211	2.7e-40	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	4.58e-64	37	212	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP91580.1|CE5	1.18e-108	1	213	1	212
ABF50887.1|CE5|3.1.1.74	7.74e-103	1	212	1	216
EAA62121.1|CE5|3.1.1.74	1.67e-102	1	212	1	218
BCS30115.1|CE5	5.10e-99	1	212	1	213
QMW35358.1|CE5	1.51e-96	1	212	1	212

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GBS_A	4.96e-96	17	212	1	196	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	1.29e-91	27	212	2	187	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	3.46e-80	17	212	1	198	Chain A, cutinase [Malbranchea cinnamomea]
1CUY_A	1.18e-59	21	212	10	207	Chain A, CUTINASE [Fusarium vanettenii]
1XZJ_A	3.35e-59	21	212	10	207	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CES4|CUTI2_ASPTN	8.43e-110	1	213	1	216	Probable cutinase 2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=ATEG_07810 PE=3 SV=1
sp|B6H2E9|CUTI2_PENRW	2.10e-109	1	213	1	212	Probable cutinase 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=Pc13g05110 PE=3 SV=1
sp|Q5AVY9|CUTI2_EMENI	1.37e-103	1	212	1	216	Cutinase 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut2 PE=1 SV=2
sp|Q4WQV2|CUTI2_ASPFU	1.24e-99	1	212	1	212	Probable cutinase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_4G14120 PE=3 SV=1
sp|B0Y537|CUTI2_ASPFC	1.24e-99	1	212	1	212	Probable cutinase 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_071270 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000345	0.999617	CS pos: 24-25. Pr: 0.9561

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_493134-t37_1-p1.