CAZyme Information: P170DRAFT_492565-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_492565-t37_1-p1
• CAZy Family: GT32
• CAZyme Description: Six-hairpin glycosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
660		72273.56	5.7236

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000003:2431292-2433336(+)

Full Sequence      

MRLYSLPLLATAALAIPYSEYILAPSSRTLTPPSIYRTEGSVSNASSLLHENSTTPTTLH
GKSSITFDFQKNIAGLVSLDVSDSSASDAFIGVTFSESSLYVSSEACDATADAGLDSPLW
FNVGAGSGVYTAEEKHVRGGFRYMTIVSNTTADVSLNSVTVNFTAAPKQDLTAYTGYFHC
DDELLNRIWYAGAYTNQLCTIDPEMGNSLVWYQIINKTQTIELPETVDWWSNYTISNGSS
VLTDGAKRDRLVWPGDMSVQLEVVGVSTYDLYSMRNALERLLVLQKADGRLPYASPPYAD
TVSFTYHCQSLVGIYFYYLYSGDRAWLARHWTQFKLGVDWALGSVDDSGLANITASSDWL
RFGMGGHNIEANAILYYTLNQGLTLSSLLNDTTPQQNWTRTASRIKSSANHLLWDASAGL
YIDNQTTTMHPQDGNVWAIKANLTNSTTQSTQLTRALRSRWGPYGAPAPEAGATVSPFIS
SLELQAHFMASDAQSALDLMRRSWGFMLDDPRMTNSTFIEGFSTNGSLHYEPYANDPRVS
HAHGWATGPTSALTHYAAGLRITKDAGQEWEVAPQPGDLKSVHAGFETVKGQFAVRFERE
SNATEAGYRSLELRTPRGTVGTVRLPGVEGELVSGNGTTVRLRSGKVSGLEGGNWRLVRR

Enzyme Prediction     

EC	3.2.1.40:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	237	625	3.9e-73	0.7361111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.85e-12	175	509	3	302	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	3.77e-08	559	635	1	73	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK42566.1|GH78	6.25e-308	56	660	6	606
BCR95812.1|GH78	2.13e-306	8	657	10	653
BCS08346.1|GH78	2.13e-306	8	657	10	653
BAF98236.1|GH78|3.2.1.40	2.13e-306	8	657	10	653
QBS54793.1|GH78	4.44e-306	8	657	10	653

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.15e-20	130	623	265	707	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	3.65e-10	241	556	234	541	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

P170DRAFT_492565-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000490	0.999489	CS pos: 15-16. Pr: 0.9536

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_492565-t37_1-p1.