CAZyme Information: P170DRAFT_479945-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_479945-t37_1-p1
• CAZy Family: GT31
• CAZyme Description: capsule-associated protein CAP1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518	MSFO01000009|CGC8	60327.06	6.7782

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000009:235195-236751(-)

Full Sequence      

MVPYFANLWTIYVADNTIVQNHPITNLMENARVQFHEALDKQSRTYSTACEEYRHRYKIE
PPQGFEDWYKFASAHQSPIIDDFDAIYNSIRPLLSLSGREVNENLNNARDLPGNELWSCT
FFGSLLTTKCSHDSRVFDRHIQHSFDSLLETIPATLPDVTFLVNHLDEPRMILPPPINSH
NDLNIKDQARQVTWHTVTDSCAYQIGKTKTRKPNAVEHPELPFVIDSALDQDLCLHPEYS
TMHGMFLSPTSFRPIEGLVPVLSPGSPSTMGDILYPSPAYMEPEFEYNASKDIDWEKKQN
KLYWAGSTTGGFALNDDWRQFHRQRFVGLVQNRERRRFPYLYQNKDGSINLSKSTFLNSR
LFDVAFTRICQCETKYCRDQRRYFHTHSWADKDRGLQSRLVFDLDGNGISGRFYSLLASK
SAPLKQTLFREWHDDRLKPWVHYIPVSQSMDELPEMVRYFASRAGQKKAREIADNGRDWF
SKSFRPVDLTIYLYRLLLEIARLQDVDRPALQLVEETL

Enzyme Prediction     

No EC number prediction in P170DRAFT_479945-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	237	504	2.1e-73	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.48e-13	256	504	28	253	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	4.78e-06	399	518	217	341	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR96444.1|GT90	4.85e-245	1	516	314	833
BCS08956.1|GT90	7.88e-235	28	516	1	493
CAK47563.1|GT90	4.28e-201	28	516	1	461
UKZ86599.1|GT90	5.03e-200	2	510	105	623
UPK91004.1|GT90	1.43e-198	1	510	315	829

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	6.99e-06	203	502	61	340	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.28e-42	22	508	152	660	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	5.63e-06	397	497	281	382	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q29AU6|RUMI_DROPS	5.71e-06	431	514	313	400	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_479945-t37_1-p1.