CAZyme Information: P170DRAFT_479929-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_479929-t37_1-p1
• CAZy Family: GT31
• CAZyme Description: cutinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
227		24533.43	4.6293

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000009:186018-186857(+)

Full Sequence      

MKHRFITGLFLAGALAAPAPQEKCAPGPHIITVRESSAPPDGGFVRDLANEVQAKLNESD
IESDIEDVDYPAWFVPYVHSETEGVKKAREAIENYVESCPQTDIILLGYSQGAHAIGDVL
CGTNNPLFGKSDPLPTANLGDHVKAVVLMGDPGHEPGVSFDVGTSTKPGLFHRFTDIECP
GYSDKIQSYCDSNDPFCDRGLNQNVHNGYIKEYGDQAVKFVVAKVQG

Enzyme Prediction     

No EC number prediction in P170DRAFT_479929-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	26	224	1.1e-42	0.9788359788359788

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.45e-41	24	225	1	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC87770.1|CE5	3.70e-55	24	227	31	229
AMW08145.1|CE5	1.79e-45	12	227	20	237
CEI64478.1|CE5	1.66e-44	10	226	10	224
CCT62942.1|CE5	3.04e-44	6	222	7	220
UPK99293.1|CE5	1.62e-43	7	223	8	220

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QOZ_A	8.04e-34	75	221	55	202	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
1BS9_A	1.13e-33	26	225	3	206	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	1.13e-33	26	225	3	206	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	4.47e-33	26	225	3	206	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59893|AXE2_TALPU	2.70e-34	5	225	6	233	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	3.90e-32	75	221	86	233	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	6.62e-32	9	225	7	229	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|O06319|CULP4_MYCTU	6.20e-16	9	225	33	226	Phospholipase Culp4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut4 PE=1 SV=3
sp|O06793|CULP5_MYCTU	1.22e-11	42	225	3	173	Probable carboxylesterase Culp5 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004476	0.995491	CS pos: 23-24. Pr: 0.4526

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_479929-t37_1-p1.