CAZyme Information: P170DRAFT_479820-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_479820-t37_1-p1
• CAZy Family: GT31
• CAZyme Description: mannan endo-1,6-alpha-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456		50132.10	4.9242

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000008:1648444-1649974(+)

Full Sequence      

MRYLPWAPLLTVLLAGQAAVSQIQLDVGDPKSIKNAAATSAYNMMNNYHGNESGQIPGKL
PDTWWEGGAMFMTLIQYWFWTGDTSYNEVTTQGMLWQKGNNDYFPANDSNFLGNDDQVFW
GLAAITAAELNFPEEDGQPSWLSLAQGVFNTQVPRWDTSACQGGLRWQIFPYQAGYTTKN
AISNGGLFQLAARLGRYTNNETYTEWAEKIWDWSATTPLLKMDEWTIADTTTMETQCTDH
GDLQWTYNYGTYLSGAAYMYNLTNGGVKWKKAIDGYLGTTLDKFFPKEFGGNVMSEISCE
PNMMCDRNQDCFKGFLSSWLTFMTTIVPHTANQIIPKIQASAQAAAKQCSGGSTKTQCGR
RWHQDSWDGSKGLEQDMSALSVFASSMITHKPQGHSPLTADTGGTSKSDPTAGSGPQKQP
NTPRPITTGDRAGASILTVVVAGGWLAAVAWMVYGG

Enzyme Prediction     

No EC number prediction in P170DRAFT_479820-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	31	400	2.7e-104	0.9608938547486033

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.60e-174	32	380	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	0.007	115	253	93	215	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR95806.1|GH76	2.28e-273	6	456	8	462
BCS08339.1|GH76	2.28e-273	6	456	8	462
CAK43770.1|GH76	4.53e-267	6	456	8	456
QMW25974.1|GH76	6.68e-267	6	456	7	457
QRD87981.1|GH76	6.68e-267	6	456	7	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.53e-95	16	431	18	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	9.52e-107	23	454	22	449	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	6.19e-104	14	454	10	446	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	2.03e-103	23	453	22	450	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q5AD78|DCW1_CANAL	3.31e-99	23	453	19	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	1.38e-98	9	413	9	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000374	0.999597	CS pos: 21-22. Pr: 0.8814

TMHMM  Annotations     

Start	End
432	454