CAZyme Information: P170DRAFT_477509-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_477509-t37_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510		57057.51	4.8013

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000006:865391-867064(+)

Full Sequence      

MKCITLTTLYLCSELSYASWSPPPEYALYTSANGHFFQLSDGSPFFWQADTAWTLMTRLN
YTETELYLADRASKGFNIVEAIGPSSDGLDGQNRQGDLAFIDMDVHHPNEAYWTYVDSVV
ELAWKRHGIRVALFPAWGNYVHNSENVAGPLNTSNAGVLGEFIGKRYPYLPKILFGDINP
TWQNKTQVKAEYADGGVPSDYETIDWLPVYDALAEGIIRGEKAVIRNSTDSADYAPLISL
HNQNQWFSGAPLALASSEAGHRSWLTFDIAQSGHSDYPPNPPINWWNCRRGYETVELMYA
VGETRPGKKRPALDNEPHYEGRYNNARDWLPVWNASDVRVGTWQTVFSGAAGAVYGADMV
WQMYNPSLSESNGGGPAIPWYEAINLPGSEQIQFVKKAVFDRGNSSFFDRVPAPEIIVGN
AGANDKKTKALRDSNGSWIMVYTPTGKPFSIDTKDIKGCDVNARWYDPLSGHYIEMAYTQ
CENNTTIREFRPPKADTHDDWALVLESNIS

Enzyme Prediction     

No EC number prediction in P170DRAFT_477509-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	29	502	4e-86	0.9878640776699029

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	1.79e-78	33	397	1	315	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	1.96e-24	411	506	1	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAE8332162.1|GH140	3.64e-223	18	507	19	509
KAE8313632.1|GH140	5.17e-223	18	507	19	509
KAB8203844.1|GH140	1.48e-222	1	507	3	509
KAE8156220.1|GH140	1.48e-222	18	506	19	508
KAF2451303.1|GH140	6.27e-222	5	508	16	531

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	3.93e-46	13	471	6	413	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	9.49e-43	13	471	6	413	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	9.77e-38	9	471	15	429	Chain A, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

P170DRAFT_477509-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000518	0.999448	CS pos: 18-19. Pr: 0.9756

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_477509-t37_1-p1.