CAZyme Information: P170DRAFT_477372-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_477372-t37_1-p1
• CAZy Family: GT20
• CAZyme Description: beta-glucosidase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842	MSFO01000006|CGC4	91281.33	5.5048

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000006:522804-525509(-)

Full Sequence      

MTSNIDPAFQHIASADLDALLKQLTIDEKIALLSGDDFWHTVAIPRLNIPAIRLSDGPNG
IRGTKFFGSVPSGCFPCGTAIGATFDQDLALKVGHLLADEAKAKGAHVVLGPTINIARGP
LGGRGFESYSEDPVLSGVLAGQYCSGLQEKGIAATLKHFVCNDMEHQRMAYNSILTDRAL
REIYLLPFMIAIAQGKPDAIMTAYNKVNGTHAAENPTILRDILRGEWGWEGLVMSDWFGT
YSTSEAVLAGLDLEMPGPTRWRGGALAHAVTANKVPMADLNARVRAVLQLVQKASRSGVP
QHAPEGQLNRAEDRRLLRQIAAEAIVLLKNEDNILPLNKTKRVAVIGPNAKVASYCGGGS
ASLNPYQAVTPFDGLSASAPGNVEFAQGVYGHQNLPLLGKLMHTKDGQTGFTLRAYNEPP
TVSNRRIVEERVETDSNLFLIDYSHPELESVWYADAEGYLTPSESGVYDIGLTVHGTGKL
YVDGELLINNADVQRPGTSFLGNGTLEEIASLQLEAGKAYHIHIQWGCAKTSTFKIPGVV
DFGHGGFRFGACKQLPPADGIAQAVQLAANVDQVVLVAGLSAEWESEGEDRPNMALPPYN
DELISRVLEANPNTVVVIQSGTPVEMPWIHKAKAVLHAWYGGNETGHGLADVVFGDVNPS
GKLPLTFPQKLKDNPTYFNFRSEGGRVLYGEDVYVGYRYYDTLEVEPLFPFGHGLSYTTF
ELSNLQLKKDSDRDLTVGCTLANTGSRSGAEVIQVYVAPVSPPLKRPQKELKAFSKLTLN
AGESRPVEIPLDLVRATSYWDEYTNSWCSHSGTYNIMAGTSSRGIFLEASVELSETTFWQ
GL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	43	256	2.7e-66	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.03e-85	15	833	36	764	beta-glucosidase BglX.
224389	BglX	2.57e-76	37	369	48	379	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.17e-61	325	717	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	2.41e-47	19	792	55	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	7.76e-44	46	290	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12335.1|GH3	0.0	6	842	11	846
BCS00565.1|GH3	0.0	6	842	11	846
CAK49185.1|GH3	0.0	6	842	11	846
QQK47512.1|GH3	0.0	3	841	9	847
QMW48789.1|GH3	0.0	9	841	15	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.54e-262	16	842	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.96e-257	16	842	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.31e-149	14	836	2	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.75e-122	21	833	9	663	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	5.51e-111	20	833	57	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WU49|BGLI_ASPFU	0.0	16	842	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y8M8|BGLJ_ASPFC	0.0	17	842	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|Q2U8Y5|BGLI_ASPOR	0.0	16	842	5	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	0.0	16	842	5	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|B0Y3M6|BGLI_ASPFC	0.0	16	842	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000022

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_477372-t37_1-p1.