CAZyme Information: P170DRAFT_475089-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_475089-t37_1-p1
• CAZy Family: GT2
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
848		92004.72	5.2889

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000004:403324-405870(-)

Full Sequence      

MSPETSSPLVDHLLQSLTLEEKVDLLAGKNMWETTNIDRLHIPSLKMTDGPAGARGSKWT
YGSLTTFIPCGISLAATFDPALVEKVGTVLGQETWRKGCRVLLAPTMNLSRSPLGGRNFE
GYGEDPYLVGAIATAMIRGIQSQGVAACMKHFILNDTETRRFNVDQTIDGRTLREVYMKP
FTMAVRDADPLTAMVSYPKINGLHADLSPEVLPRLLREELRFDRLVMSDWGGLNSTVESL
LATTDLEMPGPPICRGQRLLDAIRNGDINVAAHVDPSVRRMLQLLEKTGFLGNTEQIVGS
EQTTSDPNFHKIACEAAQGGLVLLKNDGVLPLRPSTLQKVAIVGPNARKPTAGGSGSAAV
NPFYITTPEECLRTALKAANPDIEVTYYPGMLDSLRAPLLGDLLTVPDGSRNGLEVNFFA
GHAFHGSVVATSLWDDSLVYLFSDGDVPASLDGRPFCYQASGLIKPQESGRYTLSLANTG
QAKLFLNDELLIDNSEWTRTTGGFLGCSSEDRTASIQLEAGRAYRLRVDNIVTLPLVKAF
DNTLFPCVSGMRIGMARDLDETAILQQAVASARQADVAVVVVGHNKDSEGEGGDRAHIQL
PGRTDELVSAVCSANPNTIVVVQSASAVTMPWVDAAPGIVMAWYQGQENGEALAQALLGH
CNFSGKLPITFPRRLEDHGSHAWFPGEAAQDRNTLGEGVLVGYRHFDAREIRPLWPFGFG
LSYTRFELADIRVSGTLSAVSPESRVLVHVRVVNVGGCDGQEVVQVYVAPSARVAEMGLV
HYQKTLAGFGKIEVAAGKAREMTISISGWEFSWYDAKAGRWQLDAGTYKCWVGRSVCEIE
KELEIVVE

Enzyme Prediction     

No EC number prediction in P170DRAFT_475089-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	36	249	2.6e-63	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.21e-63	39	355	57	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	3.72e-49	1	817	29	736	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	3.21e-47	560	723	76	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	2.42e-39	39	284	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	5.35e-30	13	806	56	742	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK48047.1|GH3	0.0	4	847	5	853
BCS13433.1|GH3	0.0	4	847	5	853
BCS01725.1|GH3	0.0	4	847	41	889
QMW31943.1|GH3	0.0	10	844	9	848
QRD91011.1|GH3	0.0	10	844	11	850

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	4.22e-151	10	848	6	837	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.16e-146	10	848	6	837	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.12e-110	10	839	5	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
4I3G_A	8.50e-98	13	839	57	820	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
5WAB_A	6.20e-91	14	839	9	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P27034|BGLS_RHIRD	1.68e-177	9	845	1	808	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q5BFG8|BGLB_EMENI	6.21e-172	10	848	11	839	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.27e-154	10	841	6	824	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1DNN8|BGLJ_NEOFI	3.67e-154	10	828	14	836	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	4.96e-154	10	841	6	824	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000029

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_475089-t37_1-p1.