CAZyme Information: P170DRAFT_474470-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_474470-t37_1-p1
• CAZy Family: GT2
• CAZyme Description: Oligoxyloglucan reducing end-specific cellobiohydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MSFO01000003|CGC5	39959.49	8.9782

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000003:3139692-3140792(+)

Full Sequence      

MGSTRLPLTILTLLFFHILLPIANASPSVITKREVRVDVKAGTMGAGTYPRATYIKDKSL
LGCFRSYKGDKLAIETVRSTDRGKTWKPVGTAITELKKEYGLNNCYLHQLPDSDRILLAF
RNPQRDAADTKYVKHIMLVYSSDDGGKTWAPLSTVATTETTGLGLWEPFMMEGLDGDLML
FYSRETRTDGKDQNSILVRSTDGGKTWGKEQTISGGDIQKRDGMLGVARVAKGSKKLIAV
FESLTPNTGITSITSDDDGKTWGNRKLVYKGTNGPPSEAAPQIVRVGEKTLVVSFSTWED
DREAGKSKPPNVKVVVSTDGGATWGQKTLVHENCHWAGEVAVDGNSLLVMCDHNDGTSVS
MRVSIH

Enzyme Prediction     

No EC number prediction in P170DRAFT_474470-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	47	302	2.1e-48	0.8664495114006515

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	6.85e-19	69	332	42	301	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	9.76e-16	126	325	37	238	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.21e-15	74	305	113	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.23e-13	175	357	24	222	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
404074	BNR_2	1.05e-08	126	325	14	199	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX58461.1|GH93	7.40e-144	1	362	1	355
QKX54349.1|GH93	2.93e-66	25	354	22	353
QKX63957.1|GH93	8.26e-63	26	354	18	355
QGA18927.1|GH93	5.05e-62	18	353	18	345
VDB90996.1|GH93	6.29e-51	45	365	45	367

PDB Hits     

P170DRAFT_474470-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

P170DRAFT_474470-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999748	CS pos: 25-26. Pr: 0.9770

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_474470-t37_1-p1.