CAZyme Information: P170DRAFT_474370-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_474370-t37_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
664		75393.03	9.4285

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000003:2868051-2870258(+)

Full Sequence      

MHKLLPIVEDIVIPESLLPAASTIPQRSSDYPRYYSEEPTREIHVQKKRQPITGRQVHEQ
QPGIERRNWSHTSALESGGSWPLPTVVEDPVISEAPEGQRISFHRPVSPSRPGLERKATN
SRISRVPFDLPRPSSSTFPERPRVGSLWELYDRAKIASLNLQRTTWVQFLFEYGVYALFV
SFVYFVLIGVPLWKGSVYWLYWAMKNKFVFQGGWSIAIGYTFVPLFSLFERDAPDNEYYQ
QRRIGRSSSDTALLIPCFKSASVIATTLEAALKLFPAGDVFVIANGDSPVPVDNTEEVCR
SYGVNHIWSPIGSKVIALFIGCYAAKAFKNVLCIDDDCTLPSNFPVVASRLTKRVRCIGY
TIKSAGCDSPETTFCQQAQDMEYKMSGLQRAFAGKIGSSTFSHGAISLWDREFLKECFQD
HPGFSISEDWFLGNSCRRMGGRIKMCSSVFVETATPSAVFYVGGERGRGRSGFGETTVFK
QRFLRWNFFFANGLYHNLAYIFGSWKLGWWEIGAKVFVFQEVYETIIYVLAPFVLPVSLL
VRPAFCVTLLGGTVGLYLIHVLIFNEIHLRLKKERIKWTVLLFYYMPYKLIITLINITSC
YWSLYKYARYFARRHPKVVEDQAAVEILLKMEMSVDDRPGTPGLGRSMTVRTLGTRSKTG
SVKS

Enzyme Prediction     

No EC number prediction in P170DRAFT_474370-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	250	460	1.5e-27	0.9347826086956522

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404520	Glyco_tranf_2_3	5.41e-30	249	460	2	218	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	1.05e-13	253	429	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	3.18e-10	252	608	57	406	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
132997	Glyco_tranf_GTA_type	2.44e-05	254	344	2	94	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
133016	Succinoglycan_BP_ExoA	0.001	253	452	4	206	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39025.1|GT2	4.87e-256	6	656	52	731
QMW36583.1|GT2	9.39e-255	6	662	8	680
QMW48638.1|GT2	9.39e-255	6	662	8	680
UDD65887.1|GT2	5.37e-254	6	662	8	680
BCR96819.1|GT2	3.54e-253	6	656	52	730

PDB Hits     

P170DRAFT_474370-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

P170DRAFT_474370-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000001

TMHMM  Annotations     

Start	End
171	193
208	230
483	502
517	539
546	568
583	605