CAZyme Information: P170DRAFT_474212-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_474212-t37_1-p1
• CAZy Family: GT2
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
716	MSFO01000003|CGC22	80496.91	5.9669

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000003:2443259-2445409(-)

Full Sequence      

MTFPVTISLQSDALQVKVHISADGIAFLQEVIPIPGSTRPSASRYFPNSFTPLLEARLAG
EGTAKHKSSKSLIGTYLGTRLKYQSHHTSTQADTKVLDVVLADDISKVTVICHLRIYRSI
PVLSSTATIRNDGDQDIVVTQLSSLVLGGLTTGSEKWWSDYTLSVPNNSWFREAQWIEHD
LPSLGVDDYGVYGRPEEHAASIAHYAVSNRGSFSTEGHLPMGLLKRTDGAETWLWQVENN
GSWRWEIGDWKDSVYVAAGGPVEADHDWREKLSPGKEFTTVPVAICHVFDNYEKAFAEMT
RYRRQMRRQHEDHKRLPIIFNDYMNCLMGDPTDEKILALVDPVVEAGAEYFVIDAGWYAD
DSGWWDDVGLWEPSKKRFPMGFKELLAQLQARGLAPGLWIEPEVVGIRSVVAQQLPEDAF
FQRDGRRIVEKGRYQLDYRHQAVRDRMHGIIHRLITDYGVGYFKFDYNIEVTQGTDISCS
SAGSGQLDHNRAYLRWVSELHDKYPALVIENCSSGAQRMDYAMLAVHALQSTSDQQDPDR
YAAIAAALPTAVTPEQGAVWAYPQPEWDDEINAMTVTNSLLGRIHLSGRLDNLQPHQFDL
IKQGMDVYRSICLDLATATAFWPLGLPHWHDDWIALGMAAQTAEGRDTGHYYISIWRRGG
AESIELPLLTFRDHAVNAQILYPASFPVNISWKPEGLLKVHIPSKMAARLLKVTVS

Enzyme Prediction     

No EC number prediction in P170DRAFT_474212-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	79	628	1.2e-93	0.7805232558139535

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269892	GH36	3.96e-81	315	609	1	298	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
307952	Melibiase	4.42e-31	294	538	14	264	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
225882	GalA	3.94e-22	186	537	156	508	Alpha-galactosidase [Carbohydrate transport and metabolism].
269893	GH27	1.48e-07	320	496	5	141	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
407116	Glyco_hydro_36N	2.63e-06	79	181	72	181	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE64621.1|GH36	0.0	1	714	1	715
QMW46905.1|GH36	0.0	1	714	58	772
QRD91154.1|GH36	0.0	1	714	58	772
QMW34832.1|GH36	0.0	1	714	58	772
UDD63863.1|GH36	0.0	1	714	1	715

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XN0_A	4.22e-24	87	520	125	538	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	5.59e-24	87	520	125	538	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
4FNR_A	7.89e-21	91	537	127	551	Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNQ_A	1.38e-20	91	537	127	551	Crystal structure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNP_A	4.19e-20	91	537	127	551	Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNP_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNS_A Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_B Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_C Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus],4FNS_D Crystal structure of GH36 alpha-galactosidase AgaA A355E from Geobacillus stearothermophilus in complex with 1-deoxygalactonojirimycin [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P43467|AGAL1_PEDPE	4.06e-24	90	523	130	539	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
sp|G1UB44|MELA_LACAC	2.17e-23	87	520	125	538	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
sp|Q9ALJ4|AGAA_GEOSE	4.06e-20	91	537	127	551	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
sp|P43469|AGAL2_PEDPE	6.97e-20	89	584	123	580	Alpha-galactosidase 2 OS=Pediococcus pentosaceus OX=1255 GN=agaS PE=3 SV=1
sp|P27756|AGAL_STRMU	1.84e-14	87	537	119	544	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_474212-t37_1-p1.