CAZyme Information: P170DRAFT_470472-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_470472-t37_1-p1
• CAZy Family: GT109
• CAZyme Description: DUF409 domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455		49347.35	8.9276

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000001:4211300-4212796(+)

Full Sequence      

MTSKSVSVSARSGLLNPSHPVRSLSVAFWLWKTVLFLVIVGCPGPGYDTSTSLLPGQGVA
PLSLPAPLKFVRWDSIYFVHIAESGYVFEQEWAFSYGYGKFIAFLTSVLNPWSNNALEGT
AGIAVVAVALSHLVHYLSVLALYRLSINVFGQETTTQRLICFLSAALHIISPAGAFLSAP
YGEPVFSFLNIAGLYIYSSSVLDSNTGSPVSRNAKLLLSGLVFSAATVVRSNGVLSGFLF
AYDALLLLQGFLSRGVSVDAVVHLGVVITSGCILSLGFVVPQVFAYMQYCMPEDVSRPWC
QRFVPSIYGWVQEHYWNVGFLRYWTVSNIPLFLLALPMLLILFQSSIWGLKASLGSTPSK
TSSTDQGASSTTRASLLLRLAVPQALLSGLAVTSYHVQIINRVSSGYPLWYWYIAHQLLG
DSGEKHGRIFTLAVQGAVIYGLIQAVLFGSFLPPA

Enzyme Prediction     

No EC number prediction in P170DRAFT_470472-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	29	455	3e-112	0.9852579852579852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.80e-37	71	455	58	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	7.09e-18	72	455	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS01167.1|GT76	1.86e-191	2	455	3	469
BCS12914.1|GT76	1.86e-191	2	455	3	469
CAK38795.1|GT76	3.89e-190	2	455	3	466
QMW40534.1|GT76	1.28e-187	10	455	8	452
QRD82967.1|GT76	5.19e-187	10	455	8	452

PDB Hits     

P170DRAFT_470472-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	8.88e-179	10	455	8	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	3.12e-161	14	455	23	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	4.26e-92	18	455	16	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	4.07e-89	18	455	8	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	1.56e-50	23	455	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.964593	0.035423

TMHMM  Annotations     

Start	End
21	43
120	142
159	181
226	248
261	283
321	343
429	451