CAZyme Information: P170DRAFT_467185-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_467185-t37_1-p1
• CAZy Family: GH95|GH1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
564		64523.72	4.7827

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000007:2119862-2121851(+)

Full Sequence      

MTRPYLSVRAILVHFLFILQLVSSQVISFDEGDLLLGARDNAATIVVLENEIKGVVRAAQ
DRALDFGRVLGTNGTLVQGDTVRNSNQQVVVIVGTIGNSTVIDKLVDKGKINISKVQGKW
ESYIQAVVDDPLPGISHAFVIAGSDKRGTIYGIYDISEAIGVSPWYWWADVPLLLRLKAN
YLWPGMKRKEAFYLDDEDDGRIAHEYGIFMGTSHHEPMAKTYYEQQYRFEGPWDWSENYG
NVVEFMRDGVNRTKDWDTLYTLGMRGDGDQESPALTSSQLEEIIQTQQDMIEELTGKELK
DVPQTWSLYKEVGRYWQAGMNVSDLVTLMWADDNFGNLLRVPWANETDRPGGAGVYYHFG
YVGDPRNYEWISTVQLVKTWEQMHLAYEKGAREIWIANSQDIKPYEIPTNHFLDMAYDMS
KFQNPESTTEWLKAWAKREFGSGIESATAEILNIYGRLVVRRKYETLSMMPFAYHVLNYD
EAENVLQEWEDLLDQARRVHDSLDQPTRDAFYELVLHQVLAGKYVQEIYIATHLGWLYKN
QKRASTNRLAAQARTAFANDAATC

Enzyme Prediction     

EC	3.2.1.131:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	173	563	1.3e-139	0.5322812051649928

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406396	Glyco_hydro_115	7.39e-151	173	465	42	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
368295	S_layer_C	0.006	84	149	147	210	S-layer like family, C-terminal region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW46604.1|GH115	5.62e-206	36	562	32	616
UDD63493.1|GH115	7.94e-206	36	562	32	616
QMW34550.1|GH115	1.59e-205	36	562	32	616
QRD88449.1|GH115	1.71e-204	3	557	2	626
QMW37650.1|GH115	1.71e-204	3	557	2	626

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	5.90e-128	32	562	12	593	Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PUG_A	3.02e-111	45	561	28	606	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	2.55e-108	45	561	27	605	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4C90_A	4.67e-103	45	562	55	622	Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
6NPS_A	2.36e-82	49	560	26	616	Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

P170DRAFT_467185-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000241	0.999757	CS pos: 24-25. Pr: 0.9792

TMHMM  Annotations     

Start	End
5	27