CAZyme Information: P170DRAFT_465629-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_465629-t37_1-p1
• CAZy Family: GH92
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
803		88054.39	4.9059

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000005:2114299-2116984(+)

Full Sequence      

MFTALNYLVVLAAFTGATGAAWNHTDYLHSPTADEIPNPNATGLYWEYAFDKATSFVSQL
TLEEKVGLVSGTEGPCVGNLMPIPRLNFTGLCIQNGPMSLEQGDHVSVFPAGITIAATWD
KNIAYERGNQLAAEFRGKGSQVILGPVAGPLGRTALGGRNWEGFSPDPFLTGELFTETIV
GTQDGGVQACAKHYIGNEQETQRQPTENEDGKTIESVSSNIDDTTMHELYLWPFQQAVKA
GVATVMCSYNRLNQTYGCQNSKILNGILKGELGFQGYVMSDWGATHSGAKAINSGEDMDM
PGTPSFGPVYWGPNLTESVKNGSVSTSRLDDMCHRVMTPYFYLNQDQGFPGVDPSSKELN
ALLFDGPELYENYNYAYGPVTNLDVRGNHDEFIRKAAAEGTVLLKNTNNTLPLKSPKQVA
VFGNDAGDFTNGMSTFYFDGVKNYEYGVLAAGGGSGSGLFSYIVSPLEAIKQRVGFKKNL
VQYILNNTAIIDEDSPNMNVLLPSQPDVCLVFLKSWATESEDRTIIAHDWNGDEVVTRVA
SGCPNTVVITHSNGINVMPWANHPNVTAILAAHLPGQEAGNSIVDVLWGDVNPSGHLPYT
IAKNESDYSFAPITNSTELTNTEDPTAWQSDFREGDLIDYRHFDFHNKSVQYEFGYGLSY
TTFSMERNMTITRTFQDTLSAVPPSANTVPGGNPHLWDNLYQITTTVKNTGHTAGATVPQ
LYLSIPKLSSTFNIEATRVLRGFYKVHLQPGESRKVTFKLTRRDISRWDVVRQKWVIPEG
DFKSWVGFSSRDFRASGSFTPLS

Enzyme Prediction     

EC	3.2.1.-:5	3.2.1.21:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	83	301	1.9e-58	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.72e-60	30	802	16	765	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	2.61e-59	401	660	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	8.92e-51	103	443	77	381	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.68e-34	108	338	87	315	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.36e-33	52	758	52	740	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO21286.1|GH3	0.0	4	802	19	832
UJO22853.1|GH3	0.0	19	803	31	815
USW52149.1|GH3	0.0	15	802	23	802
SMR50741.1|GH3	0.0	19	802	27	805
SMQ49196.1|GH3	0.0	4	802	11	819

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JU6_A	4.40e-189	6	801	3	853	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
4IIB_A	7.63e-189	37	791	11	829	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
5NBS_A	4.91e-188	38	791	30	848	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
6SZ6_A	5.19e-188	38	791	14	827	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5FJJ_A	4.73e-181	26	791	3	830	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U325|BGLG_ASPOR	1.54e-305	27	802	47	813	Probable beta-glucosidase G OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglG PE=3 SV=1
sp|B8NMR5|BGLG_ASPFN	1.54e-305	27	802	47	813	Probable beta-glucosidase G OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglG PE=3 SV=1
sp|Q5B0F4|BGLG_EMENI	1.77e-300	27	803	48	818	Probable beta-glucosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglG PE=3 SV=2
sp|Q0CUC1|BGLG_ASPTN	1.24e-292	27	803	47	814	Probable beta-glucosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglG PE=3 SV=1
sp|A1DC16|BGLG_NEOFI	2.32e-290	27	802	47	813	Probable beta-glucosidase G OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000254	0.999687	CS pos: 19-20. Pr: 0.9823

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_465629-t37_1-p1.