CAZyme Information: P170DRAFT_463871-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_463871-t37_1-p1
• CAZy Family: GH88
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
651	MSFO01000003|CGC1	67442.80	4.2290

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000003:2714487-2716490(+)

Full Sequence      

MKGAFLATAAALAGSAMADVAHMRRHDSLHQRRALQPEPEEQCGCTTEVITYYGNPTLVP
IIESTSAPVEPTSAPPAPETVTSDIVTTRHSTSYTTKTVVVSESTPAGVEPTGTPEQPAT
TAPAGTPEQPEQPEQPATGTPQQPEQPATTAPEQPEQPATTAPAVPEQPSSSAPAATPEQ
PATTAPAATPEQPETPAVTLPTPGVTNFPSTGTFTVPATTVTVTDATTVCGATTTDLPSG
SHTYGGVTTVVETATTVTCPYATVKPSGSTVTSVIETTTYVCPTPGTYTIAPTTTYVPSS
TVVVYPTPATFTPGTYTQPEQVVTVTRTDISYVCPFTGTDEPTSTPAPAPSTPAAPVTTQ
PPAAPTTSAVPTTHAAPSSSSSSQTPVPTGVSGKQMGMTYSPYTNDSNCKSKSDILSDIA
VIAEKGFSHVRVYSTDCNGLEYVGEAARKHSLKMIIGVFIDGSGISGAQEQVTAIAKWAE
WDLVTLIVVGNEAIQNGYCSASELAGFITSAKSKFEGAGYSGQITTTEPINVWEQSGSAL
CSAIDVVGANIHPFFNAEVDPKDAGTFAQKQVKILKGICSGKDVINLETGWPSQGEANGL
AVPGTSQQATAIKALVEEVGSLSVFFSYSNDLWKDAGEFNVERYWGCIDQF

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	417	649	4e-20	0.909967845659164

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.23e-58	367	651	16	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
411474	fibronec_FbpA	3.56e-08	60	197	131	256	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
223021	PHA03247	3.16e-07	56	203	2686	2831	large tegument protein UL36; Provisional
236766	rne	7.88e-06	60	203	862	1010	ribonuclease E; Reviewed
223021	PHA03247	1.53e-05	33	203	2781	2951	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR87253.1|GH17	3.36e-200	4	651	3	650
QMW26283.1|GH17	3.38e-198	1	651	1	601
BAE55626.1|GH17	3.38e-198	1	651	1	601
QRD87628.1|GH17	3.38e-198	1	651	1	601
UCK58824.1|GH17	3.38e-198	1	651	1	601

PDB Hits     

P170DRAFT_463871-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2US39|BTGE_ASPOR	6.01e-199	1	651	1	601	Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgE PE=3 SV=1
sp|B8MXP5|BTGE_ASPFN	6.01e-199	1	651	1	601	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1
sp|A1C499|BTGE_ASPCL	1.60e-194	1	651	1	564	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1
sp|B0Y9Q9|BTGE_ASPFC	1.74e-191	1	651	1	564	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|Q4WC60|BTGE_ASPFU	1.74e-191	1	651	1	564	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000849	0.999146	CS pos: 18-19. Pr: 0.9710

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_463871-t37_1-p1.