CAZyme Information: P170DRAFT_461755-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_461755-t37_1-p1
• CAZy Family: GH78
• CAZyme Description: putative fungal chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237	MSFO01000002|CGC8	24982.86	3.5716

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000002:386435-387255(-)

Full Sequence      

MHYATLAALLSAGLVSAYDVPDNLRQIYDNHKSGKCNNKLAGGFTDGISGESTFAYCGDI
DGAIFLHSSGNGGQYDNMDVDCDGANNTGGDCANDPSGQGQTAFMDSLNQYGIDDLDANV
HPYVVFGNSDFDPQEYGMEPLSVMAVVCGDQLFYGIWGDTNGADSTGEASISLAQLCYPD
DGLTGDNGHGEDDVLYIGFTGKNAVPGDEADWTTDDTEAFEESIKELGDKLVAGLQD

Enzyme Prediction     

EC	3.2.1.132:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	7	233	5.5e-83	0.9772727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	6.22e-90	78	233	1	164	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJG44374.1|GH75	4.01e-127	2	235	3	240
BAE63840.1|GH75	4.04e-109	1	236	1	244
BAA92250.1|GH75|3.2.1.132	4.04e-109	1	236	1	244
QMW33508.1|GH75	4.04e-109	1	236	1	244
UDD62306.1|GH75	4.04e-109	1	236	1	244

PDB Hits     

P170DRAFT_461755-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	1.75e-128	1	235	1	240	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	7.18e-110	1	236	1	244	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	7.18e-110	1	236	1	244	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q2U1H5|CSNB_ASPOR	2.28e-105	6	236	3	240	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q8NK76|CSNB_ASPOZ	2.17e-98	6	236	3	239	Endo-chitosanase B OS=Aspergillus oryzae OX=5062 GN=csnB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000231	0.999743	CS pos: 17-18. Pr: 0.9802

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_461755-t37_1-p1.